Videos by DailyGrommet Videos by DailyGrommet http://revver.com/u/DailyGrommet/ http://revver.com webmaster@revver.com Amber Chand - Unique Gifts to Help a Charity Fri, 20 Mar 2009 15:36:37 -0800

Author: DailyGrommet
Added: Fri, 20 Mar 2009 15:36:37 -0800
Duration: 355

Daily Grommet discovered Amber Chand Gift Collection thanks to one of our visitors. You will feel as if you stepped into the bazaar of the world when you access this website. Amber, herself a refugee, knows first-hand the plight of women in areas of conflict and with her website provides a world-wide stage for unique, well made items that will provide income and work for these resilient women. http://www.dailygrommet.com

]]> amberbasketsbraceletcandlechandcollectioncraftsmanshipdailydarfureachfairgiftgiftsindividualinitiativeisraeljewelrykabulnecklaceone-stoppackagespalestinepricesrefugeeshoppingstorysuperiorsupportuniquewith http://revver.com/video/1522141/amber-chand-unique-gifts-to-help-a-charity/ http://revver.com/watch/1522141 Amber Chand - Unique Gifts to Help a Charity Daily Grommet discovered Amber Chand Gift Collection thanks to one of our visitors. You will feel as if you stepped into the bazaar of the world when you access this website. Amber, herself a refugee, knows first-hand the plight of women in areas of conflict and with her website provides a world-wide stage for unique, well made items that will provide income and work for these resilient women. http://www.dailygrommet.com Daily Grommet discovered Amber Chand Gift Collection thanks to one of our visitors. You will feel as if you stepped into the bazaar of the world when you access this website. Amber, herself a refugee, knows first-hand the plight of women in areas of conflict and with her website provides a world-wide stage for unique, well made items that will provide income and work for these resilient women. http://www.dailygrommet.com DailyGrommet DailyGrommet amber baskets bracelet candle chand collection craftsmanship daily darfur each fair gift gifts individual initiative israel jewelry kabul necklace one-stop packages palestine prices refugee shopping story superior support unique with nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Peanut-Free Barney Butter - unique gifts Tue, 17 Mar 2009 02:33:24 -0800

Author: DailyGrommet
Added: Tue, 17 Mar 2009 02:33:24 -0800
Duration: 180

We hope you enjoy Barney Butter as much as we do here at Daily Grommet. This unique, mom-powered product is a great peanut-free butter that kids and adults will enjoy. Made from roasted almonds, it is as nutritious as it is delicious, and a great answer to, "What's for lunch?". Find this with more unique and creative gifts at http://www.dailygrommet.com

]]> allergiesalmondbarneybuttercreamycreativecrunchydailyfoodforfriendsgiftgiftsgreatgrommetkidsnonotoilypeanutpeanut-freeproductsprotein-richsalmonellasaltyscaresnacktexturetrans-fatsunique http://revver.com/video/1539416/peanut-free-barney-butter-unique-gifts/ http://revver.com/watch/1539416 Peanut-Free Barney Butter - unique gifts We hope you enjoy Barney Butter as much as we do here at Daily Grommet. This unique, mom-powered product is a great peanut-free butter that kids and adults will enjoy. Made from roasted almonds, it is as nutritious as it is delicious, and a great answer to, "What's for lunch?". Find this with more unique and creative gifts at http://www.dailygrommet.com We hope you enjoy Barney Butter as much as we do here at Daily Grommet. This unique, mom-powered product is a great peanut-free butter that kids and adults will enjoy. Made from roasted almonds, it is as nutritious as it is delicious, and a great answer to, "What's for lunch?". Find this with more unique and creative gifts at http://www.dailygrommet.com DailyGrommet DailyGrommet allergies almond barney butter creamy creative crunchy daily food for friends gift gifts great grommet kids no not oily peanut peanut-free products protein-rich salmonella salty scare snack texture trans-fats unique nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ FiftyP money management website for kids - personal finance Sun, 15 Mar 2009 19:40:04 -0800

Author: DailyGrommet
Added: Sun, 15 Mar 2009 19:40:04 -0800
Duration: 175

The FiftyP money management website is one of Daily Grommet's favorite online destinations. FiftyP helps teach kids about earning, saving, and spending money in a safe environment controlled by their parents. It's a great way to help children learn about financial responsibility, and FiftyP donates 50% of their profits to causes chosen by the community of kids using the service. http://www.dailygrommet.com

]]> allowancefiftypfinanceforinvestmentskidsmanagementmoneyonlinepersonal http://revver.com/video/1534404/fiftyp-money-management-website-for-kids-personal-finance/ http://revver.com/watch/1534404 FiftyP money management website for kids - personal finance The FiftyP money management website is one of Daily Grommet's favorite online destinations. FiftyP helps teach kids about earning, saving, and spending money in a safe environment controlled by their parents. It's a great way to help children learn about financial responsibility, and FiftyP donates 50% of their profits to causes chosen by the community of kids using the service. http://www.dailygrommet.com The FiftyP money management website is one of Daily Grommet's favorite online destinations. FiftyP helps teach kids about earning, saving, and spending money in a safe environment controlled by their parents. It's a great way to help children learn about financial responsibility, and FiftyP donates 50% of their profits to causes chosen by the community of kids using the service. http://www.dailygrommet.com DailyGrommet DailyGrommet allowance fiftyp finance for investments kids management money online personal nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bowchies Pet Collars & Leashes Unique Gifts, Creative Gifts Sun, 15 Mar 2009 19:40:04 -0800

Author: DailyGrommet
Added: Sun, 15 Mar 2009 19:40:04 -0800
Duration: 177

This great find and truly creative gift idea has pet lovers at Daily Grommet buzzing. Bowchies collars and leashes withstand dips in the ocean and rolls in mud. They're unique, durable, adorable, and reasonably priced. What's not to like? More gifts for your pets at Daily Grommet, http://www.dailygrommet

]]> bowchiescatcollarcreativedailydogdogsdrydurablegiftsgrommetlabradorleashnylonodorpetresistantretrieversmellswimthatuniquewebbing http://revver.com/video/1532613/bowchies-pet-collars-leashes-unique-gifts-creative-gifts/ http://revver.com/watch/1532613 Bowchies Pet Collars & Leashes Unique Gifts, Creative Gifts This great find and truly creative gift idea has pet lovers at Daily Grommet buzzing. Bowchies collars and leashes withstand dips in the ocean and rolls in mud. They're unique, durable, adorable, and reasonably priced. What's not to like? More gifts for your pets at Daily Grommet, http://www.dailygrommet This great find and truly creative gift idea has pet lovers at Daily Grommet buzzing. Bowchies collars and leashes withstand dips in the ocean and rolls in mud. They're unique, durable, adorable, and reasonably priced. What's not to like? More gifts for your pets at Daily Grommet, http://www.dailygrommet DailyGrommet DailyGrommet bowchies cat collar creative daily dog dogs dry durable gifts grommet labrador leash nylon odor pet resistant retriever smell swim that unique webbing nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Go GaGa- Patented Ergonomic Bags - unique gifts Thu, 12 Mar 2009 20:33:26 -0800

Author: DailyGrommet
Added: Thu, 12 Mar 2009 20:33:26 -0800
Duration: 322

The team at Daily Grommet loves this versatile, unique bag for diapers, laptops, and more. The wide, comfortable, ergonomic strap makes toting a heavy load easier by distributing weight more evenly across your back and shoulder. In three styles and six colors, it offers many options for busy parents - the perfect gift idea. Moms and dads will love the simple, modern, utilitarian style. Some of the bags are made from sturdy ballistic nylon, others from recycled materials. Find even more unique gifts on our website: http://www.dailygrommet.com

]]> backbagbasicdailydesigndiaperergonomicgagagiftsgogrommetlaptopmessengermodernneckpainshouldersimplestraptoteuniquewide http://revver.com/video/1530439/go-gaga-patented-ergonomic-bags-unique-gifts/ http://revver.com/watch/1530439 Go GaGa- Patented Ergonomic Bags - unique gifts The team at Daily Grommet loves this versatile, unique bag for diapers, laptops, and more. The wide, comfortable, ergonomic strap makes toting a heavy load easier by distributing weight more evenly across your back and shoulder. In three styles and six colors, it offers many options for busy parents - the perfect gift idea. Moms and dads will love the simple, modern, utilitarian style. Some of the bags are made from sturdy ballistic nylon, others from recycled materials. Find even more unique gifts on our website: http://www.dailygrommet.com The team at Daily Grommet loves this versatile, unique bag for diapers, laptops, and more. The wide, comfortable, ergonomic strap makes toting a heavy load easier by distributing weight more evenly across your back and shoulder. In three styles and six colors, it offers many options for busy parents - the perfect gift idea. Moms and dads will love the simple, modern, utilitarian style. Some of the bags are made from sturdy ballistic nylon, others from recycled materials. Find even more unique gifts on our website: http://www.dailygrommet.com DailyGrommet DailyGrommet back bag basic daily design diaper ergonomic gaga gifts go grommet laptop messenger modern neck pain shoulder simple strap tote unique wide nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ EveryWear Child Carrier from lillebaby - Unique shower and baby gifts Tue, 10 Mar 2009 20:34:56 -0800

Author: DailyGrommet
Added: Tue, 10 Mar 2009 20:34:56 -0800
Duration: 131

The Daily Grommet crew loves this versatile child carrier. Lillebaby EveryWear offers five baby holds in one product. It's lightweight, easy to pack, and dads aren't embarrassed to be wearing it. This is a unique baby shower gift sure to be prized by new parents. See more creative gifts at http://www.dailygrommet.com

]]> babybackpackbergbrendacarriercarrychildcreativedailyeverywearfrontgeargiftsgrommethiplillebabynorwegianscandinavianshowersideslingswedishuniquewrap http://revver.com/video/1528588/everywear-child-carrier-from-lillebaby-unique-shower-and-baby-gifts/ http://revver.com/watch/1528588 EveryWear Child Carrier from lillebaby - Unique shower and baby gifts The Daily Grommet crew loves this versatile child carrier. Lillebaby EveryWear offers five baby holds in one product. It's lightweight, easy to pack, and dads aren't embarrassed to be wearing it. This is a unique baby shower gift sure to be prized by new parents. See more creative gifts at http://www.dailygrommet.com The Daily Grommet crew loves this versatile child carrier. Lillebaby EveryWear offers five baby holds in one product. It's lightweight, easy to pack, and dads aren't embarrassed to be wearing it. This is a unique baby shower gift sure to be prized by new parents. See more creative gifts at http://www.dailygrommet.com DailyGrommet DailyGrommet baby backpack berg brenda carrier carry child creative daily everywear front gear gifts grommet hip lillebaby norwegian scandinavian shower side sling swedish unique wrap nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Clocky-Never Over Sleep Again - unique gifts Tue, 10 Mar 2009 14:31:58 -0800

Author: DailyGrommet
Added: Tue, 10 Mar 2009 14:31:58 -0800
Duration: 175

Daily Grommet is excited to share the Clocky, an MIT-made alarm clock for snoozers. The Clocky actually runs away once you've pressed snooze so that when it's time to get up, Clocky has your full attention. See more at www.dailygrommet.com

]]> alarmclockclockydailygadgetsgaurigiftgiftsgraduationgrommethomemitnandauniquewheeled http://revver.com/video/1526580/clocky-never-over-sleep-again-unique-gifts/ http://revver.com/watch/1526580 Clocky-Never Over Sleep Again - unique gifts Daily Grommet is excited to share the Clocky, an MIT-made alarm clock for snoozers. The Clocky actually runs away once you've pressed snooze so that when it's time to get up, Clocky has your full attention. See more at www.dailygrommet.com Daily Grommet is excited to share the Clocky, an MIT-made alarm clock for snoozers. The Clocky actually runs away once you've pressed snooze so that when it's time to get up, Clocky has your full attention. See more at www.dailygrommet.com DailyGrommet DailyGrommet alarm clock clocky daily gadgets gauri gift gifts graduation grommet home mit nanda unique wheeled nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Indika Tree of Life Applique Unique Gifts to Help a Charity Fri, 06 Mar 2009 00:31:48 -0800

Author: DailyGrommet
Added: Fri, 06 Mar 2009 00:31:48 -0800
Duration: 168

Indika's Tree of Life Applique Wall Hangings caught Daily Grommet's attention because they're hand-made by a cooperative of women in India who keep traditional skills alive while working to find self-sustainable ways to improve their quality of life. The result is a breathtaking artisan piece representing the connection between mankind and the environment; it's the perfect gift for any pivotal life event. http://www.dailygrommet.com

]]> appliqueartisanartworkbaptismdailyeco-awareeco-consciousgiftgraduationgrommethand-madehangingindiaindikalifeself-sustainabletreeuniquewallweddingwomen http://revver.com/video/1520413/indika-tree-of-life-applique-unique-gifts-to-help-a-charity/ http://revver.com/watch/1520413 Indika Tree of Life Applique Unique Gifts to Help a Charity Indika's Tree of Life Applique Wall Hangings caught Daily Grommet's attention because they're hand-made by a cooperative of women in India who keep traditional skills alive while working to find self-sustainable ways to improve their quality of life. The result is a breathtaking artisan piece representing the connection between mankind and the environment; it's the perfect gift for any pivotal life event. http://www.dailygrommet.com Indika's Tree of Life Applique Wall Hangings caught Daily Grommet's attention because they're hand-made by a cooperative of women in India who keep traditional skills alive while working to find self-sustainable ways to improve their quality of life. The result is a breathtaking artisan piece representing the connection between mankind and the environment; it's the perfect gift for any pivotal life event. http://www.dailygrommet.com DailyGrommet DailyGrommet applique artisan artwork baptism daily eco-aware eco-conscious gift graduation grommet hand-made hanging india indika life self-sustainable tree unique wall wedding women nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Nondyebo Art, Aprons - unique gifts to help a charity Thu, 05 Mar 2009 14:49:43 -0800

Author: DailyGrommet
Added: Thu, 05 Mar 2009 14:49:43 -0800
Duration: 175

Daily Grommet loves these aprons that showcase real African art. Nondyebo's colorful graphic designs will make bold statements in your home. All your friends will want to know where you got that great apron that almost always looks new and hides all the wear and tear of an afternoon at the stove.

]]> africanapronartartsboldcolorfulcraftswomandailydesignsgiftgrommetindependentlinennon-fadingnondyebopaintedsupporttextiletribaluniquewashable http://revver.com/video/1518725/nondyebo-art-aprons-unique-gifts-to-help-a-charity/ http://revver.com/watch/1518725 Nondyebo Art, Aprons - unique gifts to help a charity Daily Grommet loves these aprons that showcase real African art. Nondyebo's colorful graphic designs will make bold statements in your home. All your friends will want to know where you got that great apron that almost always looks new and hides all the wear and tear of an afternoon at the stove. Daily Grommet loves these aprons that showcase real African art. Nondyebo's colorful graphic designs will make bold statements in your home. All your friends will want to know where you got that great apron that almost always looks new and hides all the wear and tear of an afternoon at the stove. DailyGrommet DailyGrommet african apron art arts bold colorful craftswoman daily designs gift grommet independent linen non-fading nondyebo painted support textile tribal unique washable nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Kamibashi - String Dolls - unique gifts Tue, 03 Mar 2009 19:52:43 -0800

Author: DailyGrommet
Added: Tue, 03 Mar 2009 19:52:43 -0800
Duration: 161

The Daily Grommet has been captivated by the fun, quirky personalities of Kamabashi's The String Doll Gang. Hand-made in Thailand, each doll is a continuous piece of cotton string fashioned into a tiny doll with a unique uplifting message. With over 90 different dolls from which to choose, there's a character suitable for bringing a smile to every occasion -- no voodoo dolls here! More unique gifts at http://www.dailygrommet.com

]]> artasiancorporatedailydolldollsfavorsfundraisersganggiftsgiveawaysgrommethand-madejust-becausekamabashikeychainsstringthailandthetinyuniquewedding http://revver.com/video/1517420/kamibashi-string-dolls-unique-gifts/ http://revver.com/watch/1517420 Kamibashi - String Dolls - unique gifts The Daily Grommet has been captivated by the fun, quirky personalities of Kamabashi's The String Doll Gang. Hand-made in Thailand, each doll is a continuous piece of cotton string fashioned into a tiny doll with a unique uplifting message. With over 90 different dolls from which to choose, there's a character suitable for bringing a smile to every occasion -- no voodoo dolls here! More unique gifts at http://www.dailygrommet.com The Daily Grommet has been captivated by the fun, quirky personalities of Kamabashi's The String Doll Gang. Hand-made in Thailand, each doll is a continuous piece of cotton string fashioned into a tiny doll with a unique uplifting message. With over 90 different dolls from which to choose, there's a character suitable for bringing a smile to every occasion -- no voodoo dolls here! More unique gifts at http://www.dailygrommet.com DailyGrommet DailyGrommet art asian corporate daily doll dolls favors fundraisers gang gifts giveaways grommet hand-made just-because kamabashi keychains string thailand the tiny unique wedding nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ WatersEnd Valentines Kit - Unique Valentine's Day Gifts Wed, 04 Feb 2009 17:16:40 -0800

Author: DailyGrommet
Added: Wed, 04 Feb 2009 17:16:40 -0800
Duration: 151

Daily Grommet found this unique gift for Valentine's Day - a Valentine's kit that includes 12 cards, 12 envelopes in high quality paper stock. It also has over 100 decorative materials including ribbon, felt, and decorative papers. This makes a unique gift for parents who enjoy doing craft projects with kids, or buy the set for your own family, and in one afternoon at the kitchen table, make original Valentines gifts for the whole family. http://www.dailygrommet.com

]]> artscardchildchildrenchildrenscraftcraftsdaddailydaydo-it-yourselfgiftsgradeschoolgrandmagrandpagrandparentgrommetindependentkidkitmomparentproductproductsschoolscrapbookinguniquevalentineswatersend http://revver.com/video/1467910/watersend-valentines-kit-unique-valentines-day-gifts/ http://revver.com/watch/1467910 WatersEnd Valentines Kit - Unique Valentine's Day Gifts Daily Grommet found this unique gift for Valentine's Day - a Valentine's kit that includes 12 cards, 12 envelopes in high quality paper stock. It also has over 100 decorative materials including ribbon, felt, and decorative papers. This makes a unique gift for parents who enjoy doing craft projects with kids, or buy the set for your own family, and in one afternoon at the kitchen table, make original Valentines gifts for the whole family. http://www.dailygrommet.com Daily Grommet found this unique gift for Valentine's Day - a Valentine's kit that includes 12 cards, 12 envelopes in high quality paper stock. It also has over 100 decorative materials including ribbon, felt, and decorative papers. This makes a unique gift for parents who enjoy doing craft projects with kids, or buy the set for your own family, and in one afternoon at the kitchen table, make original Valentines gifts for the whole family. http://www.dailygrommet.com DailyGrommet DailyGrommet arts card child children childrens craft crafts dad daily day do-it-yourself gifts gradeschool grandma grandpa grandparent grommet independent kid kit mom parent product products school scrapbooking unique valentines watersend nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ MixMyGranola - Unique Valentine's Day Gifts Wed, 04 Feb 2009 17:16:40 -0800

Author: DailyGrommet
Added: Wed, 04 Feb 2009 17:16:40 -0800
Duration: 189

Daily Grommet loves MixMyGranola's personalized granola service - so personal and unique. It's a great gift too, but especially fun for Valentine's Day. Choose a 16-ounce granola base and layer in high quality, all-natural ingredients (dried fruits, nuts, and other goodies). You can name your mix, and reorder easily. More than a billion variations are available. http://www.dailygrommet.com

]]> blendbreakfastcerealcustomdailydaygiftgiftsgranolagrommetindependentmixmypersonalproductsuniquevalentines http://revver.com/video/1470491/mixmygranola-unique-valentines-day-gifts/ http://revver.com/watch/1470491 MixMyGranola - Unique Valentine's Day Gifts Daily Grommet loves MixMyGranola's personalized granola service - so personal and unique. It's a great gift too, but especially fun for Valentine's Day. Choose a 16-ounce granola base and layer in high quality, all-natural ingredients (dried fruits, nuts, and other goodies). You can name your mix, and reorder easily. More than a billion variations are available. http://www.dailygrommet.com Daily Grommet loves MixMyGranola's personalized granola service - so personal and unique. It's a great gift too, but especially fun for Valentine's Day. Choose a 16-ounce granola base and layer in high quality, all-natural ingredients (dried fruits, nuts, and other goodies). You can name your mix, and reorder easily. More than a billion variations are available. http://www.dailygrommet.com DailyGrommet DailyGrommet blend breakfast cereal custom daily day gift gifts granola grommet independent mix my personal products unique valentines nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Sassy Sauces Sampler - Valentine's gifts for girlfriends Tue, 27 Jan 2009 23:31:37 -0800

Author: DailyGrommet
Added: Tue, 27 Jan 2009 23:31:37 -0800
Duration: 212

Daily Grommet loves Sassy Sauces all natural gourmet dessert sauces! They're one-of-a-kind sauces made in small artisanal batches. This great gift for chocolate-loving girlfriends - think Valentine's Day - includes four 10 oz. jars of spicy dark chocolate (wonderfully complex), rum caramel (a hit with sophisticated foodies!), milk chocolate caramel (our testers' favorite), and bittersweet chocolate (amazing). And as for what you do with them, the possibilities are endless: Spoon on ice cream, make truffles, hot chocolate, fondue, and more this Valentine's Day. http://www.dailygrommet.com

]]> belgiancaramelchocolatecocoacreamdailydayfondueforfrenchgiftgiftsgirlfriendsgrommethoticerumsemi-sweetuniquevalentines http://revver.com/video/1465339/sassy-sauces-sampler-valentines-gifts-for-girlfriends/ http://revver.com/watch/1465339 Sassy Sauces Sampler - Valentine's gifts for girlfriends Daily Grommet loves Sassy Sauces all natural gourmet dessert sauces! They're one-of-a-kind sauces made in small artisanal batches. This great gift for chocolate-loving girlfriends - think Valentine's Day - includes four 10 oz. jars of spicy dark chocolate (wonderfully complex), rum caramel (a hit with sophisticated foodies!), milk chocolate caramel (our testers' favorite), and bittersweet chocolate (amazing). And as for what you do with them, the possibilities are endless: Spoon on ice cream, make truffles, hot chocolate, fondue, and more this Valentine's Day. http://www.dailygrommet.com Daily Grommet loves Sassy Sauces all natural gourmet dessert sauces! They're one-of-a-kind sauces made in small artisanal batches. This great gift for chocolate-loving girlfriends - think Valentine's Day - includes four 10 oz. jars of spicy dark chocolate (wonderfully complex), rum caramel (a hit with sophisticated foodies!), milk chocolate caramel (our testers' favorite), and bittersweet chocolate (amazing). And as for what you do with them, the possibilities are endless: Spoon on ice cream, make truffles, hot chocolate, fondue, and more this Valentine's Day. http://www.dailygrommet.com DailyGrommet DailyGrommet belgian caramel chocolate cocoa cream daily day fondue for french gift gifts girlfriends grommet hot ice rum semi-sweet unique valentines nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Luxe Link Purse Hook - Valentine's Day gifts for girlfriends Tue, 27 Jan 2009 10:52:38 -0800

Author: DailyGrommet
Added: Tue, 27 Jan 2009 10:52:38 -0800
Duration: 173

Daily Grommet loves Luxe Link purse hooks. This great gift for girlfriends is small, stylish (recycled zinc alloy paired with vintage Asian designs), and either attach to your purse strap or tuck into its own little suede pouch when not in use. When you get to your destination, just rest the round, decorative top on the table, and hook your purse strap on the chain link that hangs off to the side. It will hold a bag up to 9 pounds, and your bag's weight helps hold it in place. http://www.dailygrommet.com

]]> badchinesedailydayfloorforgiftsgirlfriendsgrommethandbaghooklinkluckluxeoffproverbpursesuperstitionuniquevalentines http://revver.com/video/1462859/luxe-link-purse-hook-valentines-day-gifts-for-girlfriends/ http://revver.com/watch/1462859 Luxe Link Purse Hook - Valentine's Day gifts for girlfriends Daily Grommet loves Luxe Link purse hooks. This great gift for girlfriends is small, stylish (recycled zinc alloy paired with vintage Asian designs), and either attach to your purse strap or tuck into its own little suede pouch when not in use. When you get to your destination, just rest the round, decorative top on the table, and hook your purse strap on the chain link that hangs off to the side. It will hold a bag up to 9 pounds, and your bag's weight helps hold it in place. http://www.dailygrommet.com Daily Grommet loves Luxe Link purse hooks. This great gift for girlfriends is small, stylish (recycled zinc alloy paired with vintage Asian designs), and either attach to your purse strap or tuck into its own little suede pouch when not in use. When you get to your destination, just rest the round, decorative top on the table, and hook your purse strap on the chain link that hangs off to the side. It will hold a bag up to 9 pounds, and your bag's weight helps hold it in place. http://www.dailygrommet.com DailyGrommet DailyGrommet bad chinese daily day floor for gifts girlfriends grommet handbag hook link luck luxe off proverb purse superstition unique valentines nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Gazelle - Cash In Your Old Gadgets- Personal Finance Choices Sat, 24 Jan 2009 20:33:21 -0800

Author: DailyGrommet
Added: Sat, 24 Jan 2009 20:33:21 -0800
Duration: 154

Daily Grommet is featuring Gazelle, a website that buys back many types of used electronics, and keeps them out of landfills by reselling through retail, wholesale, and recycling channels. They consider themselves part of the "recommerce" effort, a new movement to realize the value of reuse as a powerful first step in recycling. Just go to the site, search for the device you're trying to sell, answer some questions about it, and get a quote on most items instantly. Old gadgets can make you money - a smart personal finance choice! http://www.dailygrommet.

]]> celldailydevicedisposaldriveselectronicelectronicsexternalfinancegaminggazellegetgreengrommetlaptopmoneyoldpersonalphonerecommercerecycleridsellsystemused http://revver.com/video/1455916/gazelle-cash-in-your-old-gadgets-personal-finance-choices/ http://revver.com/watch/1455916 Gazelle - Cash In Your Old Gadgets- Personal Finance Choices Daily Grommet is featuring Gazelle, a website that buys back many types of used electronics, and keeps them out of landfills by reselling through retail, wholesale, and recycling channels. They consider themselves part of the "recommerce" effort, a new movement to realize the value of reuse as a powerful first step in recycling. Just go to the site, search for the device you're trying to sell, answer some questions about it, and get a quote on most items instantly. Old gadgets can make you money - a smart personal finance choice! http://www.dailygrommet. Daily Grommet is featuring Gazelle, a website that buys back many types of used electronics, and keeps them out of landfills by reselling through retail, wholesale, and recycling channels. They consider themselves part of the "recommerce" effort, a new movement to realize the value of reuse as a powerful first step in recycling. Just go to the site, search for the device you're trying to sell, answer some questions about it, and get a quote on most items instantly. Old gadgets can make you money - a smart personal finance choice! http://www.dailygrommet. DailyGrommet DailyGrommet cell daily device disposal drives electronic electronics external finance gaming gazelle get green grommet laptop money old personal phone recommerce recycle rid sell system used nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Chalk-a-Doodle Placemat Wed, 21 Jan 2009 19:52:34 -0800

Author: DailyGrommet
Added: Wed, 21 Jan 2009 19:52:34 -0800
Duration: 117

Daily Grommet is pleased to share this tabletop activity placemat that can keep little diners busy or mount on the wall or door. A truly unique gift idea,it includes recycled felt eraser, a box of colored chalk,adhesive squares and chalk ledge for hanging on wall or door. Designer Lisa Lowe draws on personal inspiration for Or's practical and innovative household items, and her bestselling placemat-cum-chalkboard is clearly the product of her unique experience as a mom. You can create games for your kids to play, draw on it, share lists and messages, etc. A perfect gift idea! http://www.dailygrommet.com

]]> chalk-a-doodledailydinediningdinnerentertainedforgamegiftgiftsgrommetideasinkeepkidsoreoriginalsoutplaytotoyunique http://revver.com/video/1453652/chalk-a-doodle-placemat/ http://revver.com/watch/1453652 Chalk-a-Doodle Placemat Daily Grommet is pleased to share this tabletop activity placemat that can keep little diners busy or mount on the wall or door. A truly unique gift idea,it includes recycled felt eraser, a box of colored chalk,adhesive squares and chalk ledge for hanging on wall or door. Designer Lisa Lowe draws on personal inspiration for Or's practical and innovative household items, and her bestselling placemat-cum-chalkboard is clearly the product of her unique experience as a mom. You can create games for your kids to play, draw on it, share lists and messages, etc. A perfect gift idea! http://www.dailygrommet.com Daily Grommet is pleased to share this tabletop activity placemat that can keep little diners busy or mount on the wall or door. A truly unique gift idea,it includes recycled felt eraser, a box of colored chalk,adhesive squares and chalk ledge for hanging on wall or door. Designer Lisa Lowe draws on personal inspiration for Or's practical and innovative household items, and her bestselling placemat-cum-chalkboard is clearly the product of her unique experience as a mom. You can create games for your kids to play, draw on it, share lists and messages, etc. A perfect gift idea! http://www.dailygrommet.com DailyGrommet DailyGrommet chalk-a-doodle daily dine dining dinner entertained for game gift gifts grommet ideas in keep kids ore originals out play to toy unique nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Obama Flash Bag Tote Tue, 20 Jan 2009 20:33:34 -0800

Author: DailyGrommet
Added: Tue, 20 Jan 2009 20:33:34 -0800
Duration: 138

In honor of today's inauguration, Daily Grommet is featuring this large tote bag with a photo of President Barack Obama -- today's unique gift idea. It's made from color copies which are then laminated and strengthened inside with a sandwich of eight sheets of recycled newsprint. Images cover every panel of the bag, inside and out, and each panel is embroidered with colorful swoops and swirls that compliment the composition of the images. These bags make great,unique gifts and are designed and produced in Burlington, Vermont. http://dailygrommet.com

]]> bagbarackdailyecoflashgiftgiftsgreengrommetideasinaugurationindependentobamapresidentproductproductsrecycledsturdytoteunique http://revver.com/video/1451428/obama-flash-bag-tote/ http://revver.com/watch/1451428 Obama Flash Bag Tote In honor of today's inauguration, Daily Grommet is featuring this large tote bag with a photo of President Barack Obama -- today's unique gift idea. It's made from color copies which are then laminated and strengthened inside with a sandwich of eight sheets of recycled newsprint. Images cover every panel of the bag, inside and out, and each panel is embroidered with colorful swoops and swirls that compliment the composition of the images. These bags make great,unique gifts and are designed and produced in Burlington, Vermont. http://dailygrommet.com In honor of today's inauguration, Daily Grommet is featuring this large tote bag with a photo of President Barack Obama -- today's unique gift idea. It's made from color copies which are then laminated and strengthened inside with a sandwich of eight sheets of recycled newsprint. Images cover every panel of the bag, inside and out, and each panel is embroidered with colorful swoops and swirls that compliment the composition of the images. These bags make great,unique gifts and are designed and produced in Burlington, Vermont. http://dailygrommet.com DailyGrommet DailyGrommet bag barack daily eco flash gift gifts green grommet ideas inauguration independent obama president product products recycled sturdy tote unique nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Sno Wovel - Snow Shovel on Wheels - Independent Products Tue, 20 Jan 2009 01:52:36 -0800

Author: DailyGrommet
Added: Tue, 20 Jan 2009 01:52:36 -0800
Duration: 132

This shovel, featured by Daily Grommet, cleverly uses wheels and a lever to take the struggle out of shoveling snow. Proven to reduce strain on the heart and back by University of Massachusetts researchers, this independent product is great for anyone who wants an eco-friendly and body-friendly shoveling solution. It's great for seniors, or anyone who appreciates gadgets that make chores a little easier! This shovel assembles in 5 minutes, and the polyproplene blade won't rust. http://www.dailygrommet.com

]]> arthritisbackblizzardblowerdailyfinancegrommethearthomeiceindependentjointmaintenancemoneymuscleolderonpainpersonalproductproductsseniorshovelshovelingsnosnowstrainwheelwinterwovel http://revver.com/video/1448983/sno-wovel-snow-shovel-on-wheels-independent-products/ http://revver.com/watch/1448983 Sno Wovel - Snow Shovel on Wheels - Independent Products This shovel, featured by Daily Grommet, cleverly uses wheels and a lever to take the struggle out of shoveling snow. Proven to reduce strain on the heart and back by University of Massachusetts researchers, this independent product is great for anyone who wants an eco-friendly and body-friendly shoveling solution. It's great for seniors, or anyone who appreciates gadgets that make chores a little easier! This shovel assembles in 5 minutes, and the polyproplene blade won't rust. http://www.dailygrommet.com This shovel, featured by Daily Grommet, cleverly uses wheels and a lever to take the struggle out of shoveling snow. Proven to reduce strain on the heart and back by University of Massachusetts researchers, this independent product is great for anyone who wants an eco-friendly and body-friendly shoveling solution. It's great for seniors, or anyone who appreciates gadgets that make chores a little easier! This shovel assembles in 5 minutes, and the polyproplene blade won't rust. http://www.dailygrommet.com DailyGrommet DailyGrommet arthritis back blizzard blower daily finance grommet heart home ice independent joint maintenance money muscle older on pain personal product products senior shovel shoveling sno snow strain wheel winter wovel nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ DERMAdoctor Body Scrub - Daily Independent Products Sat, 17 Jan 2009 13:52:37 -0800

Author: DailyGrommet
Added: Sat, 17 Jan 2009 13:52:37 -0800
Duration: 114

Daily Grommet introduces a dermatologist-tested body scrub that provides quality exfoliation by combining the best of a mini-chemical peel and microdermabrasion into a single effective, less irritating treatment. It's great on dry, flaky patches and "chicken skin"bumps associated with keratosis pilaris and other general dry skin concerns. It is easy to use, too. Just moisten skin with water, apply a small amount of product and gently exfoliate with fingertips. This independent product is a great way to deal with dry, dull winter skin. http://dailygrommet.com

]]> acidbodybumpychickendailydermadoctordermatologistdrydutyglycolicgrommetindependentkeratosiskppilarisproductproductsscrubskinsmooth http://revver.com/video/1443564/dermadoctor-body-scrub-daily-independent-products/ http://revver.com/watch/1443564 DERMAdoctor Body Scrub - Daily Independent Products Daily Grommet introduces a dermatologist-tested body scrub that provides quality exfoliation by combining the best of a mini-chemical peel and microdermabrasion into a single effective, less irritating treatment. It's great on dry, flaky patches and "chicken skin"bumps associated with keratosis pilaris and other general dry skin concerns. It is easy to use, too. Just moisten skin with water, apply a small amount of product and gently exfoliate with fingertips. This independent product is a great way to deal with dry, dull winter skin. http://dailygrommet.com Daily Grommet introduces a dermatologist-tested body scrub that provides quality exfoliation by combining the best of a mini-chemical peel and microdermabrasion into a single effective, less irritating treatment. It's great on dry, flaky patches and "chicken skin"bumps associated with keratosis pilaris and other general dry skin concerns. It is easy to use, too. Just moisten skin with water, apply a small amount of product and gently exfoliate with fingertips. This independent product is a great way to deal with dry, dull winter skin. http://dailygrommet.com DailyGrommet DailyGrommet acid body bumpy chicken daily dermadoctor dermatologist dry duty glycolic grommet independent keratosis kp pilaris product products scrub skin smooth nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Root Cellar Preserves Pickle Sampler Gift Wed, 14 Jan 2009 21:52:38 -0800

Author: DailyGrommet
Added: Wed, 14 Jan 2009 21:52:38 -0800
Duration: 176

Daily Grommet is featuring Root Cellar Preserves, an independent company dedicated to bringing back the art of pickling. A fund from their profits helps preserve early American homesteads (where much of that pickling tradition took hold). Their products are delicious, and sure to please the pickle lovers in your family. This gift basket from Root Cellar Preserves features three of their most popular gourmet pickles. http://dailygrommet.com

]]> applebrinecellarcinnamondailydillgiftgrommethotindependentpackpicklespicklingpreservesproductproductsrootspicesweettradition http://revver.com/video/1439040/root-cellar-preserves-pickle-sampler-gift/ http://revver.com/watch/1439040 Root Cellar Preserves Pickle Sampler Gift Daily Grommet is featuring Root Cellar Preserves, an independent company dedicated to bringing back the art of pickling. A fund from their profits helps preserve early American homesteads (where much of that pickling tradition took hold). Their products are delicious, and sure to please the pickle lovers in your family. This gift basket from Root Cellar Preserves features three of their most popular gourmet pickles. http://dailygrommet.com Daily Grommet is featuring Root Cellar Preserves, an independent company dedicated to bringing back the art of pickling. A fund from their profits helps preserve early American homesteads (where much of that pickling tradition took hold). Their products are delicious, and sure to please the pickle lovers in your family. This gift basket from Root Cellar Preserves features three of their most popular gourmet pickles. http://dailygrommet.com DailyGrommet DailyGrommet apple brine cellar cinnamon daily dill gift grommet hot independent pack pickles pickling preserves product products root spice sweet tradition nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Creamore Mill String Tidy - Daily Independent Products Tue, 13 Jan 2009 14:52:38 -0800

Author: DailyGrommet
Added: Tue, 13 Jan 2009 14:52:38 -0800
Duration: 121

Daily Grommet has already discovered dozens of uses for this handy spool and scissors combo. Made of wood and featuring natural cotton string, the Creamore String Tidy is an attractive and functional addition to your craft room, kitchen or office. This independent product is a Daily Grommet exclusive, and the first time this English product has been available in the United States. http://dailygrommet.com

]]> creamoredailyenglishgardengiftgrommethandyindependentkitchenproductproductsscissorspoolstringsustainablethreadtidytietwineuniquewoodwrapping http://revver.com/video/1436821/creamore-mill-string-tidy-daily-independent-products/ http://revver.com/watch/1436821 Creamore Mill String Tidy - Daily Independent Products Daily Grommet has already discovered dozens of uses for this handy spool and scissors combo. Made of wood and featuring natural cotton string, the Creamore String Tidy is an attractive and functional addition to your craft room, kitchen or office. This independent product is a Daily Grommet exclusive, and the first time this English product has been available in the United States. http://dailygrommet.com Daily Grommet has already discovered dozens of uses for this handy spool and scissors combo. Made of wood and featuring natural cotton string, the Creamore String Tidy is an attractive and functional addition to your craft room, kitchen or office. This independent product is a Daily Grommet exclusive, and the first time this English product has been available in the United States. http://dailygrommet.com DailyGrommet DailyGrommet creamore daily english garden gift grommet handy independent kitchen product products scissor spool string sustainable thread tidy tie twine unique wood wrapping nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Birds and Bees Books by Robie H. Harris- Independent Products Mon, 12 Jan 2009 19:52:38 -0800

Author: DailyGrommet
Added: Mon, 12 Jan 2009 19:52:38 -0800
Duration: 216

Daily Grommet wants to know if you dread discussing the birds and the bees with your kids? Talking to children about sex is hard. Fortunately author Robie H. Harris boldly goes where parents are often scared to venture. Her books are our independent-minded products for the day. Cleverly illustrated in a child-friendly-yet-anatomically-correct way by illustrator Michael Emberley, they'll help you give your children the answers they crave with a minimum of embarrassment for all concerned. http://dailygrommet.com

]]> aboutamazingbeesbirdschildrendailydiscussedemberleygrommethharrishealthindependentitskidsmichaelnormalnotperfectlyproductproductsrobiesexsexualsostorktalkingtowith http://revver.com/video/1434705/birds-and-bees-books-by-robie-h-harris-independent-products/ http://revver.com/watch/1434705 Birds and Bees Books by Robie H. Harris- Independent Products Daily Grommet wants to know if you dread discussing the birds and the bees with your kids? Talking to children about sex is hard. Fortunately author Robie H. Harris boldly goes where parents are often scared to venture. Her books are our independent-minded products for the day. Cleverly illustrated in a child-friendly-yet-anatomically-correct way by illustrator Michael Emberley, they'll help you give your children the answers they crave with a minimum of embarrassment for all concerned. http://dailygrommet.com Daily Grommet wants to know if you dread discussing the birds and the bees with your kids? Talking to children about sex is hard. Fortunately author Robie H. Harris boldly goes where parents are often scared to venture. Her books are our independent-minded products for the day. Cleverly illustrated in a child-friendly-yet-anatomically-correct way by illustrator Michael Emberley, they'll help you give your children the answers they crave with a minimum of embarrassment for all concerned. http://dailygrommet.com DailyGrommet DailyGrommet about amazing bees birds children daily discuss ed emberley grommet h harris health independent its kids michael normal not perfectly product products robie sex sexual so stork talking to with nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Poochie Bells Fri, 09 Jan 2009 21:52:35 -0800

Author: DailyGrommet
Added: Fri, 09 Jan 2009 21:52:35 -0800
Duration: 106

Even dumb dogs can be trained to use this doggie doorbell system featured by Daily Grommet.The perfect gift for girlfriends tired of dog-scratched doors, this independent product lets your dog let you know when she needs a walk. Poochie Bells come in lots of colors, so they can match your home decor. It's a great gift for dog-loving friends and girlfriends. http://www.dailygrommet.com

]]> animalbackyardbellsdailydogdoggiedoordoorbellforgiftgirlfriendsgrommethousebreakinghousebrokenindependentpaperpetpoochieproductproductspuppytraintrainingwalking http://revver.com/video/1429951/poochie-bells/ http://revver.com/watch/1429951 Poochie Bells Even dumb dogs can be trained to use this doggie doorbell system featured by Daily Grommet.The perfect gift for girlfriends tired of dog-scratched doors, this independent product lets your dog let you know when she needs a walk. Poochie Bells come in lots of colors, so they can match your home decor. It's a great gift for dog-loving friends and girlfriends. http://www.dailygrommet.com Even dumb dogs can be trained to use this doggie doorbell system featured by Daily Grommet.The perfect gift for girlfriends tired of dog-scratched doors, this independent product lets your dog let you know when she needs a walk. Poochie Bells come in lots of colors, so they can match your home decor. It's a great gift for dog-loving friends and girlfriends. http://www.dailygrommet.com DailyGrommet DailyGrommet animal backyard bells daily dog doggie door doorbell for gift girlfriends grommet housebreaking housebroken independent paper pet poochie product products puppy train training walking nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Amazon's Subscribe & Save Shopping Program Thu, 08 Jan 2009 18:49:40 -0800

Author: DailyGrommet
Added: Thu, 08 Jan 2009 18:49:40 -0800
Duration: 148

Daily Grommet features a smart idea from Amazon - good for your wallet and personal finances. Get household staples through Amazon's Subscribe and Save that are smart to buy in bulk shipped free to your house each month, all for 15% off. You're charged when the items ship, not all up front. And you can sign up for whatever delivery intervals you'd like: once a month, once every other month, once a quarter, or twice a year. Amazon's Subscribe and Save Service will help you save money and better manage your household finances. http://www.dailygrommet.com

]]> amazonbulkbuyfinancefinancesfreehouseholdmoneynecessitiesoffpercentpersonalprogramsavesavingserviceshipshippingshoppingstaplessubscribesupplies http://revver.com/video/1427458/amazons-subscribe-save-shopping-program/ http://revver.com/watch/1427458 Amazon's Subscribe & Save Shopping Program Daily Grommet features a smart idea from Amazon - good for your wallet and personal finances. Get household staples through Amazon's Subscribe and Save that are smart to buy in bulk shipped free to your house each month, all for 15% off. You're charged when the items ship, not all up front. And you can sign up for whatever delivery intervals you'd like: once a month, once every other month, once a quarter, or twice a year. Amazon's Subscribe and Save Service will help you save money and better manage your household finances. http://www.dailygrommet.com Daily Grommet features a smart idea from Amazon - good for your wallet and personal finances. Get household staples through Amazon's Subscribe and Save that are smart to buy in bulk shipped free to your house each month, all for 15% off. You're charged when the items ship, not all up front. And you can sign up for whatever delivery intervals you'd like: once a month, once every other month, once a quarter, or twice a year. Amazon's Subscribe and Save Service will help you save money and better manage your household finances. http://www.dailygrommet.com DailyGrommet DailyGrommet amazon bulk buy finance finances free household money necessities off percent personal program save saving service ship shipping shopping staples subscribe supplies nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ DeLonghi Safe Heat, Portable Space Heater- Personal finances Thu, 08 Jan 2009 01:52:44 -0800

Author: DailyGrommet
Added: Thu, 08 Jan 2009 01:52:44 -0800
Duration: 131

Daily Grommet is featuring this economical radiator that lets you take a room from too cool to cozy in seconds. It's sleek, portable or wall mounted, and safe for your family -- and it's a smart personal finance choice because you save on your energy bills. You'll love this independent product from DeLonghi. Get more enjoyment out of the chilly rooms in your house without having to turn up the thermostat. http://www.dailygrommet.com

]]> dailydelonghieconomicalefficientelectricenergygrommetheatheaterindependentmountedportableproductproductsradiatorsafesmallspacethermostatwall http://revver.com/video/1425358/delonghi-safe-heat-portable-space-heater-personal-finances/ http://revver.com/watch/1425358 DeLonghi Safe Heat, Portable Space Heater- Personal finances Daily Grommet is featuring this economical radiator that lets you take a room from too cool to cozy in seconds. It's sleek, portable or wall mounted, and safe for your family -- and it's a smart personal finance choice because you save on your energy bills. You'll love this independent product from DeLonghi. Get more enjoyment out of the chilly rooms in your house without having to turn up the thermostat. http://www.dailygrommet.com Daily Grommet is featuring this economical radiator that lets you take a room from too cool to cozy in seconds. It's sleek, portable or wall mounted, and safe for your family -- and it's a smart personal finance choice because you save on your energy bills. You'll love this independent product from DeLonghi. Get more enjoyment out of the chilly rooms in your house without having to turn up the thermostat. http://www.dailygrommet.com DailyGrommet DailyGrommet daily delonghi economical efficient electric energy grommet heat heater independent mounted portable product products radiator safe small space thermostat wall nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Elizabeth Colburn Enzyme Face Peel Tue, 06 Jan 2009 17:52:34 -0800

Author: DailyGrommet
Added: Tue, 06 Jan 2009 17:52:34 -0800
Duration: 192

This face peel is a great gift for girlfriends and today's Daily Grommet featured independent product. It uses enzymes to remove layers of dead skin and impurities. Just apply to dry skin, let dry for 5 minutes, roll off with fingers and rinse with water. Find out more how you -- and your girlfriends -- can benefit from Elizabeth Colburn's amazing enzyme face peel at http://www.dailygrommet.com

]]> clearcolburndailyelizabethenzymefacefacialforgiftgirlfriendsgommagegrommetimpurityindependentmaskpeelproductproductsskinsmoothtreatmentwrinkle http://revver.com/video/1423277/elizabeth-colburn-enzyme-face-peel/ http://revver.com/watch/1423277 Elizabeth Colburn Enzyme Face Peel This face peel is a great gift for girlfriends and today's Daily Grommet featured independent product. It uses enzymes to remove layers of dead skin and impurities. Just apply to dry skin, let dry for 5 minutes, roll off with fingers and rinse with water. Find out more how you -- and your girlfriends -- can benefit from Elizabeth Colburn's amazing enzyme face peel at http://www.dailygrommet.com This face peel is a great gift for girlfriends and today's Daily Grommet featured independent product. It uses enzymes to remove layers of dead skin and impurities. Just apply to dry skin, let dry for 5 minutes, roll off with fingers and rinse with water. Find out more how you -- and your girlfriends -- can benefit from Elizabeth Colburn's amazing enzyme face peel at http://www.dailygrommet.com DailyGrommet DailyGrommet clear colburn daily elizabeth enzyme face facial for gift girlfriends gommage grommet impurity independent mask peel product products skin smooth treatment wrinkle nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mint - Free Personal Finance and Money Management Tool Mon, 05 Jan 2009 18:49:40 -0800

Author: DailyGrommet
Added: Mon, 05 Jan 2009 18:49:40 -0800
Duration: 166

It turns out that the best money management tool and personal finance software is completely free. Daily Grommet is featuring Mint.com, founded by Aaron Patzer, who came up with the idea back in 2005 while using Quicken to do his personal budgeting. After several hours he still couldn't answer two key questions: How much did I spend this month? And on what? (Sound familiar?) He decided he could create something better for managing personal finances. Patzer's award-winning website budget and money management website helps you consolidate all of your accounts into one easily-viewable dashboard (it even offers a handy iPhone app). Get the whole story at http://www.dailygrommet.com

]]> aaronapplicationbudgetdailyfinancefinancesgrommethabitmanagementmintmintcommoneypatzerpersonalquickensavingsoftwarespendingtool http://revver.com/video/1421119/mint-free-personal-finance-and-money-management-tool/ http://revver.com/watch/1421119 Mint - Free Personal Finance and Money Management Tool It turns out that the best money management tool and personal finance software is completely free. Daily Grommet is featuring Mint.com, founded by Aaron Patzer, who came up with the idea back in 2005 while using Quicken to do his personal budgeting. After several hours he still couldn't answer two key questions: How much did I spend this month? And on what? (Sound familiar?) He decided he could create something better for managing personal finances. Patzer's award-winning website budget and money management website helps you consolidate all of your accounts into one easily-viewable dashboard (it even offers a handy iPhone app). Get the whole story at http://www.dailygrommet.com It turns out that the best money management tool and personal finance software is completely free. Daily Grommet is featuring Mint.com, founded by Aaron Patzer, who came up with the idea back in 2005 while using Quicken to do his personal budgeting. After several hours he still couldn't answer two key questions: How much did I spend this month? And on what? (Sound familiar?) He decided he could create something better for managing personal finances. Patzer's award-winning website budget and money management website helps you consolidate all of your accounts into one easily-viewable dashboard (it even offers a handy iPhone app). Get the whole story at http://www.dailygrommet.com DailyGrommet DailyGrommet aaron application budget daily finance finances grommet habit management mint mintcom money patzer personal quicken saving software spending tool nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ I Am Not a Paper Cup by Decor Craft - Independent Products Fri, 02 Jan 2009 14:31:43 -0800

Author: DailyGrommet
Added: Fri, 02 Jan 2009 14:31:43 -0800
Duration: 132

This porcelain "to-go" cup with its silicone sippy lid is stylish and eco-friendly. You can put it in the dishwasher and the microwave, and use it over and over. It is insulated with two layers of porcelain, so it keeps coffee hot, and hands burn-free. This daily independent product is available at http://www.dailygrommet.com.

]]> amceramiccoffeecraftcupdailydecordisposabledouble-walledgrommethotiindependentinsulatedlidmugnotpaperporcelainproductproductssiliconesippyto-go http://revver.com/video/1415891/i-am-not-a-paper-cup-by-decor-craft-independent-products/ http://revver.com/watch/1415891 I Am Not a Paper Cup by Decor Craft - Independent Products This porcelain "to-go" cup with its silicone sippy lid is stylish and eco-friendly. You can put it in the dishwasher and the microwave, and use it over and over. It is insulated with two layers of porcelain, so it keeps coffee hot, and hands burn-free. This daily independent product is available at http://www.dailygrommet.com. This porcelain "to-go" cup with its silicone sippy lid is stylish and eco-friendly. You can put it in the dishwasher and the microwave, and use it over and over. It is insulated with two layers of porcelain, so it keeps coffee hot, and hands burn-free. This daily independent product is available at http://www.dailygrommet.com. DailyGrommet DailyGrommet am ceramic coffee craft cup daily decor disposable double-walled grommet hot i independent insulated lid mug not paper porcelain product products silicone sippy to-go nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Barismo Artisan Coffee- Daily Independent Product Fri, 02 Jan 2009 01:52:39 -0800

Author: DailyGrommet
Added: Fri, 02 Jan 2009 01:52:39 -0800
Duration: 221

Daily Grommet's independent product for the day is this delicious, free trade coffee from Barismo, a more socially responsible way to get your java fix. Barismo, an independent, small batch roaster, pays a fair price for the product, working directly with small farms to help them to improve quality and sustainability, and they focus on responsible green methods for transporting and storing their beans. The special Daily Grommet "Pastoral Pack" includes a 12oz bag of Kenya Kiandu roasted coffee beans, and a 12 oz bag of Guatamala Pastoral roasted coffee beans. Find out more at http://www.dailygrommet.com

]]> barismobatchcoffeedailyfreegrommetguatamalaindependentkenyakiandupastoralproductproductsroasterroastingsealsmalltradevacuum http://revver.com/video/1414245/barismo-artisan-coffee-daily-independent-product/ http://revver.com/watch/1414245 Barismo Artisan Coffee- Daily Independent Product Daily Grommet's independent product for the day is this delicious, free trade coffee from Barismo, a more socially responsible way to get your java fix. Barismo, an independent, small batch roaster, pays a fair price for the product, working directly with small farms to help them to improve quality and sustainability, and they focus on responsible green methods for transporting and storing their beans. The special Daily Grommet "Pastoral Pack" includes a 12oz bag of Kenya Kiandu roasted coffee beans, and a 12 oz bag of Guatamala Pastoral roasted coffee beans. Find out more at http://www.dailygrommet.com Daily Grommet's independent product for the day is this delicious, free trade coffee from Barismo, a more socially responsible way to get your java fix. Barismo, an independent, small batch roaster, pays a fair price for the product, working directly with small farms to help them to improve quality and sustainability, and they focus on responsible green methods for transporting and storing their beans. The special Daily Grommet "Pastoral Pack" includes a 12oz bag of Kenya Kiandu roasted coffee beans, and a 12 oz bag of Guatamala Pastoral roasted coffee beans. Find out more at http://www.dailygrommet.com DailyGrommet DailyGrommet barismo batch coffee daily free grommet guatamala independent kenya kiandu pastoral product products roaster roasting seal small trade vacuum nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Catherine Breer Wall Poster Calendar - Daily Independent Products Thu, 01 Jan 2009 12:31:42 -0800

Author: DailyGrommet
Added: Thu, 01 Jan 2009 12:31:42 -0800
Duration: 130

Daily Grommet introduces a 2009 wall poster calendar that takes you on a visual vacation every day. This independent product from annie|catherine features unique artwork of Maine, Martha's Vineyard, Bahamas landscapes. Annie Darling and Catherine Breer are business partners , artists, graphic designers, and mothers. They're based in Westbrook, Maine, and work out of a recently renovated riverside woolen mill. Find out more about the annie catherine 2009 calendar at http://www.dailygrommet.com

]]> 2009annieartbreercalendarcatherinedarlingindependentproductproductsvacation http://revver.com/video/1412780/catherine-breer-wall-poster-calendar-daily-independent-products/ http://revver.com/watch/1412780 Catherine Breer Wall Poster Calendar - Daily Independent Products Daily Grommet introduces a 2009 wall poster calendar that takes you on a visual vacation every day. This independent product from annie|catherine features unique artwork of Maine, Martha's Vineyard, Bahamas landscapes. Annie Darling and Catherine Breer are business partners , artists, graphic designers, and mothers. They're based in Westbrook, Maine, and work out of a recently renovated riverside woolen mill. Find out more about the annie catherine 2009 calendar at http://www.dailygrommet.com Daily Grommet introduces a 2009 wall poster calendar that takes you on a visual vacation every day. This independent product from annie|catherine features unique artwork of Maine, Martha's Vineyard, Bahamas landscapes. Annie Darling and Catherine Breer are business partners , artists, graphic designers, and mothers. They're based in Westbrook, Maine, and work out of a recently renovated riverside woolen mill. Find out more about the annie catherine 2009 calendar at http://www.dailygrommet.com DailyGrommet DailyGrommet 2009 annie art breer calendar catherine darling independent product products vacation nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Papier-Mch Sculpture by Joel Garcia -Independent Products Tue, 30 Dec 2008 16:33:27 -0800

Author: DailyGrommet
Added: Tue, 30 Dec 2008 16:33:27 -0800
Duration: 140

Artist Joel Garcia of Mexico City is a world-class papier-mch artist, known for his Dia de los Muertos ("Day of the Dead") sculptures. Sculptures like Garcia's help celebrate people from all walks of life, with different passions and hobbies , and his masterful technique means that a piece made from newspaper, flour, and water has all the gloss of something made from porcelain. This independent product is one-of-kind, and only one is on sale. It would make a wonderful addition to any Dia de los Muertos collection, a decorative accent to a Southwestern-style dcor, or a fine piece for folk art aficionados.

]]> allartdailydaydediafigurinefolkgarciagrommetindependentjoellosmachemexicanmexicomuertospapierpapier-mâchéproductproductssculptureskeletonsoulssouthwesternwomanyoga http://revver.com/video/1410772/papier-mch-sculpture-by-joel-garcia-independent-products/ http://revver.com/watch/1410772 Papier-Mch Sculpture by Joel Garcia -Independent Products Artist Joel Garcia of Mexico City is a world-class papier-mch artist, known for his Dia de los Muertos ("Day of the Dead") sculptures. Sculptures like Garcia's help celebrate people from all walks of life, with different passions and hobbies , and his masterful technique means that a piece made from newspaper, flour, and water has all the gloss of something made from porcelain. This independent product is one-of-kind, and only one is on sale. It would make a wonderful addition to any Dia de los Muertos collection, a decorative accent to a Southwestern-style dcor, or a fine piece for folk art aficionados. Artist Joel Garcia of Mexico City is a world-class papier-mch artist, known for his Dia de los Muertos ("Day of the Dead") sculptures. Sculptures like Garcia's help celebrate people from all walks of life, with different passions and hobbies , and his masterful technique means that a piece made from newspaper, flour, and water has all the gloss of something made from porcelain. This independent product is one-of-kind, and only one is on sale. It would make a wonderful addition to any Dia de los Muertos collection, a decorative accent to a Southwestern-style dcor, or a fine piece for folk art aficionados. DailyGrommet DailyGrommet all art daily day de dia figurine folk garcia grommet independent joel los mache mexican mexico muertos papier papier-mâché product products sculpture skeleton souls southwestern woman yoga nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Sassybax Torso Trim Shapewear Fri, 26 Dec 2008 23:52:38 -0800

Author: DailyGrommet
Added: Fri, 26 Dec 2008 23:52:38 -0800
Duration: 133

Daily Grommet has a great new independent product today: Sassybax Shapewear Bra. Perfect product for women who have a thick waist or "apple" figure, this bra smooths back fat and other below-the-bra lumps and bumps. This independent product offers support and shaping but it's comfortable to wear. It comes with or without underwire, and is available in white, nude, and black. Find out more about this unique shapewear bra at http://www.dailygrommet.com

]]> applebackbodybradailyfatfiguregrommetindependentlinelonglumpsproductproductsrollrollssassybaxshapershapewearsmoothingthicktypewaist http://revver.com/video/1403994/sassybax-torso-trim-shapewear/ http://revver.com/watch/1403994 Sassybax Torso Trim Shapewear Daily Grommet has a great new independent product today: Sassybax Shapewear Bra. Perfect product for women who have a thick waist or "apple" figure, this bra smooths back fat and other below-the-bra lumps and bumps. This independent product offers support and shaping but it's comfortable to wear. It comes with or without underwire, and is available in white, nude, and black. Find out more about this unique shapewear bra at http://www.dailygrommet.com Daily Grommet has a great new independent product today: Sassybax Shapewear Bra. Perfect product for women who have a thick waist or "apple" figure, this bra smooths back fat and other below-the-bra lumps and bumps. This independent product offers support and shaping but it's comfortable to wear. It comes with or without underwire, and is available in white, nude, and black. Find out more about this unique shapewear bra at http://www.dailygrommet.com DailyGrommet DailyGrommet apple back body bra daily fat figure grommet independent line long lumps product products roll rolls sassybax shaper shapewear smoothing thick type waist nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Sustainable Schools International Fri, 26 Dec 2008 12:33:22 -0800

Author: DailyGrommet
Added: Fri, 26 Dec 2008 12:33:22 -0800
Duration: 211

We support Sustainable Schools International. Photographers George and Kari Grady Grossman, who adopted a son in Cambodia, are honoring his birthplace by helping to build Cambodia's education system back after 30 years of constant civil war. They want to make sure the schools can stay staffed with teachers, are managed properly, and are teaching students how to make a good living without stripping the nearby rain forests of resources. Learn how to support their efforts or similar efforts on http://www.dailygrommet.com.

]]> bookbookscambodiacharitydailydonateeducationfundinggradygrommetgrossmanhelpinternationalliteracymanagementschoolschoolssuppliessupportsustainableteachteachervolunteer http://revver.com/video/1402382/sustainable-schools-international/ http://revver.com/watch/1402382 Sustainable Schools International We support Sustainable Schools International. Photographers George and Kari Grady Grossman, who adopted a son in Cambodia, are honoring his birthplace by helping to build Cambodia's education system back after 30 years of constant civil war. They want to make sure the schools can stay staffed with teachers, are managed properly, and are teaching students how to make a good living without stripping the nearby rain forests of resources. Learn how to support their efforts or similar efforts on http://www.dailygrommet.com. We support Sustainable Schools International. Photographers George and Kari Grady Grossman, who adopted a son in Cambodia, are honoring his birthplace by helping to build Cambodia's education system back after 30 years of constant civil war. They want to make sure the schools can stay staffed with teachers, are managed properly, and are teaching students how to make a good living without stripping the nearby rain forests of resources. Learn how to support their efforts or similar efforts on http://www.dailygrommet.com. DailyGrommet DailyGrommet book books cambodia charity daily donate education funding grady grommet grossman help international literacy management school schools supplies support sustainable teach teacher volunteer nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Grey 2K USA - help for a Greyhound rescue charity Thu, 25 Dec 2008 22:52:39 -0800

Author: DailyGrommet
Added: Thu, 25 Dec 2008 22:52:39 -0800
Duration: 220

Daily Grommet would like to help support the Grey 2K USA charity, a rescue organization founded to help greyhounds - we'd like to help this charity get the attention it deserves so that these greyhound race-track dogs can find the homes they deserve. At the dog track, these beautiful greyhound dogs often experience stress injuries like bone fractures and soft tissue tears. They live in warehouse-style kennels, confined for long hours each day in cages barely large enough for them to stand up or turn around. And every year, as many as 8,500 dogs are killed when they are no longer able to compete. The members of the Grey 2K USA charity help advocate for stronger dog protection laws and hope to close down existing greyhound racetracks. It's a charity we hope others will help with donations, volunteering or even adoption for the tens of thousands of dogs in need of homes. Find out how you can help this charity and others at http://www.dailygrommet.com

]]> 2kanimalcarecharitycrueltydailydoggreygreyhoundgrommethelphumaneinhumanelocalpetracetrackracingrescuesheltertrackusa http://revver.com/video/1400735/grey-2k-usa-help-for-a-greyhound-rescue-charity/ http://revver.com/watch/1400735 Grey 2K USA - help for a Greyhound rescue charity Daily Grommet would like to help support the Grey 2K USA charity, a rescue organization founded to help greyhounds - we'd like to help this charity get the attention it deserves so that these greyhound race-track dogs can find the homes they deserve. At the dog track, these beautiful greyhound dogs often experience stress injuries like bone fractures and soft tissue tears. They live in warehouse-style kennels, confined for long hours each day in cages barely large enough for them to stand up or turn around. And every year, as many as 8,500 dogs are killed when they are no longer able to compete. The members of the Grey 2K USA charity help advocate for stronger dog protection laws and hope to close down existing greyhound racetracks. It's a charity we hope others will help with donations, volunteering or even adoption for the tens of thousands of dogs in need of homes. Find out how you can help this charity and others at http://www.dailygrommet.com Daily Grommet would like to help support the Grey 2K USA charity, a rescue organization founded to help greyhounds - we'd like to help this charity get the attention it deserves so that these greyhound race-track dogs can find the homes they deserve. At the dog track, these beautiful greyhound dogs often experience stress injuries like bone fractures and soft tissue tears. They live in warehouse-style kennels, confined for long hours each day in cages barely large enough for them to stand up or turn around. And every year, as many as 8,500 dogs are killed when they are no longer able to compete. The members of the Grey 2K USA charity help advocate for stronger dog protection laws and hope to close down existing greyhound racetracks. It's a charity we hope others will help with donations, volunteering or even adoption for the tens of thousands of dogs in need of homes. Find out how you can help this charity and others at http://www.dailygrommet.com DailyGrommet DailyGrommet 2k animal care charity cruelty daily dog grey greyhound grommet help humane inhumane local pet racetrack racing rescue shelter track usa nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Ovarian Cancer Research Fund Tue, 23 Dec 2008 15:52:40 -0800

Author: DailyGrommet
Added: Tue, 23 Dec 2008 15:52:40 -0800
Duration: 247

The Ovarian Cancer Research Fund (OCRF) is a charity Daily Grommet would like to help. Dedicated to identifying and sponsoring talented researchers who want to find a method of early detection, and ultimately a cure, for ovarian cancer. Ovarian cancer is actually the deadliest gynecologic cancer, and the fifth leading cause of cancer death among women in this country. Unlike cervical cancer and breast cancer (screened by regular Pap smears and mammograms) ovarian cancer has no effective screening test. Since 1998, OCRF has awarded over $23 million grants to 128 of the brightest women and men in the field at 40 leading medical centers across the country. Daily Grommet has chosen to help this charity in the hope that we can make a difference for all women, http://www.dailygrommet.com

]]> cancercharitycuredailydeadlydetectionearlyfundgrommethelplocalocrfovarianrateresearchscreeningsurvivaltest http://revver.com/video/1398521/ovarian-cancer-research-fund/ http://revver.com/watch/1398521 Ovarian Cancer Research Fund The Ovarian Cancer Research Fund (OCRF) is a charity Daily Grommet would like to help. Dedicated to identifying and sponsoring talented researchers who want to find a method of early detection, and ultimately a cure, for ovarian cancer. Ovarian cancer is actually the deadliest gynecologic cancer, and the fifth leading cause of cancer death among women in this country. Unlike cervical cancer and breast cancer (screened by regular Pap smears and mammograms) ovarian cancer has no effective screening test. Since 1998, OCRF has awarded over $23 million grants to 128 of the brightest women and men in the field at 40 leading medical centers across the country. Daily Grommet has chosen to help this charity in the hope that we can make a difference for all women, http://www.dailygrommet.com The Ovarian Cancer Research Fund (OCRF) is a charity Daily Grommet would like to help. Dedicated to identifying and sponsoring talented researchers who want to find a method of early detection, and ultimately a cure, for ovarian cancer. Ovarian cancer is actually the deadliest gynecologic cancer, and the fifth leading cause of cancer death among women in this country. Unlike cervical cancer and breast cancer (screened by regular Pap smears and mammograms) ovarian cancer has no effective screening test. Since 1998, OCRF has awarded over $23 million grants to 128 of the brightest women and men in the field at 40 leading medical centers across the country. Daily Grommet has chosen to help this charity in the hope that we can make a difference for all women, http://www.dailygrommet.com DailyGrommet DailyGrommet cancer charity cure daily deadly detection early fund grommet help local ocrf ovarian rate research screening survival test nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Boston Health Care for the Homeless Program Mon, 22 Dec 2008 17:52:38 -0800

Author: DailyGrommet
Added: Mon, 22 Dec 2008 17:52:38 -0800
Duration: 260

Boston Health Care for the Homeless Program is a local charity that's close to our hearts. Considered a national model for compassionate and cost-effective health care, this charity deserves your help. Providers from Boston Health Care for the Homeless Program actually monitor and serve all street corners, alleys, and bridges of the city, to ensure that Boston's sick and scared are found and cared for. Find out more about how to help this charity and others like them at http://www.dailygrommet.com

]]> bostoncarecharityclinicdailyfacilityforgrommethealthhelphomelesshomelessnesshospitallocalmedicalprogramquality http://revver.com/video/1396273/boston-health-care-for-the-homeless-program/ http://revver.com/watch/1396273 Boston Health Care for the Homeless Program Boston Health Care for the Homeless Program is a local charity that's close to our hearts. Considered a national model for compassionate and cost-effective health care, this charity deserves your help. Providers from Boston Health Care for the Homeless Program actually monitor and serve all street corners, alleys, and bridges of the city, to ensure that Boston's sick and scared are found and cared for. Find out more about how to help this charity and others like them at http://www.dailygrommet.com Boston Health Care for the Homeless Program is a local charity that's close to our hearts. Considered a national model for compassionate and cost-effective health care, this charity deserves your help. Providers from Boston Health Care for the Homeless Program actually monitor and serve all street corners, alleys, and bridges of the city, to ensure that Boston's sick and scared are found and cared for. Find out more about how to help this charity and others like them at http://www.dailygrommet.com DailyGrommet DailyGrommet boston care charity clinic daily facility for grommet health help homeless homelessness hospital local medical program quality nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Little Pearl Caviar Tasting - Daily Independent Products Fri, 19 Dec 2008 17:49:37 -0800

Author: DailyGrommet
Added: Fri, 19 Dec 2008 17:49:37 -0800
Duration: 159

The Little Pearl makes caviar an affordable luxury. Choose this one of our daily independent products if you're interested in enjoying a low-key New Year's Eve, or romantic night in any time of year. This introductory caviar tasting includes one 1 oz jar of rainbow trout caviar, one 1 oz jar of paddlefish caviar, and two mother-of-pearl serving spoons, plus 15 lemon dill blini and creme fraiche. Little Pearl's fresh American caviar from sustainable fisheries and environmentally sensitive farms has won raves from chefs and food critics for its delicate and distinctive flavor and pristine presentation.

]]> affordableblinicaviardailyenvironmentallyfarmsfisheriesgrommetindependentintroductorylittleluxeluxurymotherpaddlefishpearlpricedproductproductsrainbowreasonablysensitivesustainabletastingtrout http://revver.com/video/1391290/little-pearl-caviar-tasting-daily-independent-products/ http://revver.com/watch/1391290 Little Pearl Caviar Tasting - Daily Independent Products The Little Pearl makes caviar an affordable luxury. Choose this one of our daily independent products if you're interested in enjoying a low-key New Year's Eve, or romantic night in any time of year. This introductory caviar tasting includes one 1 oz jar of rainbow trout caviar, one 1 oz jar of paddlefish caviar, and two mother-of-pearl serving spoons, plus 15 lemon dill blini and creme fraiche. Little Pearl's fresh American caviar from sustainable fisheries and environmentally sensitive farms has won raves from chefs and food critics for its delicate and distinctive flavor and pristine presentation. The Little Pearl makes caviar an affordable luxury. Choose this one of our daily independent products if you're interested in enjoying a low-key New Year's Eve, or romantic night in any time of year. This introductory caviar tasting includes one 1 oz jar of rainbow trout caviar, one 1 oz jar of paddlefish caviar, and two mother-of-pearl serving spoons, plus 15 lemon dill blini and creme fraiche. Little Pearl's fresh American caviar from sustainable fisheries and environmentally sensitive farms has won raves from chefs and food critics for its delicate and distinctive flavor and pristine presentation. DailyGrommet DailyGrommet affordable blini caviar daily environmentally farms fisheries grommet independent introductory little luxe luxury mother paddlefish pearl priced product products rainbow reasonably sensitive sustainable tasting trout nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Slide "Overneath" CD - Daily Independent Products Thu, 18 Dec 2008 18:52:36 -0800

Author: DailyGrommet
Added: Thu, 18 Dec 2008 18:52:36 -0800
Duration: 127

“Overneath” is Slide’s third CD, and it just might be their best. But, you can’t get it in the US (yet). So this is a Grommet exclusive. It is a perfect and totally-unique gift for any Irish music fan, or for that Irish American uncle who needs a new repertoire. The only way you could get closer to Ireland is to go there. And you’d have to, if you wanted to get this gorgeous CD - visit http://www.dailygrommet.com

]]> bandcdcdsdailygrommetindependentirishmusicoverneathproductproductsslidetraditional http://revver.com/video/1389258/slide-overneath-cd-daily-independent-products/ http://revver.com/watch/1389258 Slide "Overneath" CD - Daily Independent Products “Overneath” is Slide’s third CD, and it just might be their best. But, you can’t get it in the US (yet). So this is a Grommet exclusive. It is a perfect and totally-unique gift for any Irish music fan, or for that Irish American uncle who needs a new repertoire. The only way you could get closer to Ireland is to go there. And you’d have to, if you wanted to get this gorgeous CD - visit http://www.dailygrommet.com “Overneath” is Slide’s third CD, and it just might be their best. But, you can’t get it in the US (yet). So this is a Grommet exclusive. It is a perfect and totally-unique gift for any Irish music fan, or for that Irish American uncle who needs a new repertoire. The only way you could get closer to Ireland is to go there. And you’d have to, if you wanted to get this gorgeous CD - visit http://www.dailygrommet.com DailyGrommet DailyGrommet band cd cds daily grommet independent irish music overneath product products slide traditional nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mean & Wroughten Cribbage Set - Daily Independent Products Wed, 17 Dec 2008 18:52:34 -0800

Author: DailyGrommet
Added: Wed, 17 Dec 2008 18:52:34 -0800
Duration: 173

Find out why we love Mean & Wroughten's Cribbage Set. The unique design, that artist Jeff Weeks welds together from found and recycled objects, is the perfect addition to any family room. The heavy, metal design won't blow or tip over, great for a patio in the spring and summer. It's a perfect example of one of our daily independent products.

]]> &boardcardcribcribbagefamilyfoundfungameindependentmeanmetalobjectpegproductproductsrecyclescoringweldedwroughten http://revver.com/video/1386964/mean-wroughten-cribbage-set-daily-independent-products/ http://revver.com/watch/1386964 Mean & Wroughten Cribbage Set - Daily Independent Products Find out why we love Mean & Wroughten's Cribbage Set. The unique design, that artist Jeff Weeks welds together from found and recycled objects, is the perfect addition to any family room. The heavy, metal design won't blow or tip over, great for a patio in the spring and summer. It's a perfect example of one of our daily independent products. Find out why we love Mean & Wroughten's Cribbage Set. The unique design, that artist Jeff Weeks welds together from found and recycled objects, is the perfect addition to any family room. The heavy, metal design won't blow or tip over, great for a patio in the spring and summer. It's a perfect example of one of our daily independent products. DailyGrommet DailyGrommet & board card crib cribbage family found fun game independent mean metal object peg product products recycle scoring welded wroughten nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Josh Bach Baseball Theme Necktie - Independent Products Tue, 16 Dec 2008 18:49:41 -0800

Author: DailyGrommet
Added: Tue, 16 Dec 2008 18:49:41 -0800
Duration: 130

This tie comes in two clever baseball prints. The "Demolished Ballparks" print pays tribute to historic Ebbets, Connie Mack, Forbes, Crosley, Comiskey, and the Polo Grounds. The "Baseball Pitches" shows illustrations of how to throw a fastball, slider, forkball, palmball, and knuckler. These independent products are highly original and will make any baseball fan happy. The ties are 100% silk.

]]> bachballbaseballcomiskeyconniecrosleydailyebbetsfastballfieldsforbesforkballgrommetgroundsindependentjoshknuckleknucklermacknecktiepitchpitchespoloprintproductproductssilksliderthemetie http://revver.com/video/1384448/josh-bach-baseball-theme-necktie-independent-products/ http://revver.com/watch/1384448 Josh Bach Baseball Theme Necktie - Independent Products This tie comes in two clever baseball prints. The "Demolished Ballparks" print pays tribute to historic Ebbets, Connie Mack, Forbes, Crosley, Comiskey, and the Polo Grounds. The "Baseball Pitches" shows illustrations of how to throw a fastball, slider, forkball, palmball, and knuckler. These independent products are highly original and will make any baseball fan happy. The ties are 100% silk. This tie comes in two clever baseball prints. The "Demolished Ballparks" print pays tribute to historic Ebbets, Connie Mack, Forbes, Crosley, Comiskey, and the Polo Grounds. The "Baseball Pitches" shows illustrations of how to throw a fastball, slider, forkball, palmball, and knuckler. These independent products are highly original and will make any baseball fan happy. The ties are 100% silk. DailyGrommet DailyGrommet bach ball baseball comiskey connie crosley daily ebbets fastball fields forbes forkball grommet grounds independent josh knuckle knuckler mack necktie pitch pitches polo print product products silk slider theme tie nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Kidsonroof Totem, a 3-D Building Game for Kids Mon, 15 Dec 2008 17:52:40 -0800

Author: DailyGrommet
Added: Mon, 15 Dec 2008 17:52:40 -0800
Duration: 139

This 3-D building game for kids takes the classic house of cards idea to a whole new level. Totem is for kids six or older, and will likely be popular with the adults in your family, too. It includes cards printed with symbols, codes, textures and colors and plans for four structures, but the possibilities this creative game will inspire are endless. Game pieces are made from recycled, laminated cardboard.

]]> 103-darchitecturebuildingcardschildrenconstructiondailydesigneightforgamegamesgrommethousekidskidsonroofnineoldoldersevensixtotemyear http://revver.com/video/1381905/kidsonroof-totem-a-3-d-building-game-for-kids/ http://revver.com/watch/1381905 Kidsonroof Totem, a 3-D Building Game for Kids This 3-D building game for kids takes the classic house of cards idea to a whole new level. Totem is for kids six or older, and will likely be popular with the adults in your family, too. It includes cards printed with symbols, codes, textures and colors and plans for four structures, but the possibilities this creative game will inspire are endless. Game pieces are made from recycled, laminated cardboard. This 3-D building game for kids takes the classic house of cards idea to a whole new level. Totem is for kids six or older, and will likely be popular with the adults in your family, too. It includes cards printed with symbols, codes, textures and colors and plans for four structures, but the possibilities this creative game will inspire are endless. Game pieces are made from recycled, laminated cardboard. DailyGrommet DailyGrommet 10 3-d architecture building cards children construction daily design eight for game games grommet house kids kidsonroof nine old older seven six totem year nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Zipfy Freestyle Mini Luge The fastest sled game for kids Fri, 12 Dec 2008 21:52:34 -0800

Author: DailyGrommet
Added: Fri, 12 Dec 2008 21:52:34 -0800
Duration: 125

This unique mini luge-style sled turns a snow day into a game day for kids! The lightweight sled under 4 pounds which makes it easy to carry, and yet it can support up to 250 pounds (so mom and dad can give it a try too). Kids will love the unique lever that makes it both easy to maneuver and very stable. Buy two of these mini luge sleds for racing or other fun outdoor games for kids. See the Zipfy at http://www.dailygrommet.com

]]> adultschilddailyeasyforfreestylefungamegamesgiftsgrommetkidskislightweightlugeminioutdoorracingsafesledsleddingsnowsportstablewinterzipfy http://revver.com/video/1376552/zipfy-freestyle-mini-luge-the-fastest-sled-game-for-kids/ http://revver.com/watch/1376552 Zipfy Freestyle Mini Luge The fastest sled game for kids This unique mini luge-style sled turns a snow day into a game day for kids! The lightweight sled under 4 pounds which makes it easy to carry, and yet it can support up to 250 pounds (so mom and dad can give it a try too). Kids will love the unique lever that makes it both easy to maneuver and very stable. Buy two of these mini luge sleds for racing or other fun outdoor games for kids. See the Zipfy at http://www.dailygrommet.com This unique mini luge-style sled turns a snow day into a game day for kids! The lightweight sled under 4 pounds which makes it easy to carry, and yet it can support up to 250 pounds (so mom and dad can give it a try too). Kids will love the unique lever that makes it both easy to maneuver and very stable. Buy two of these mini luge sleds for racing or other fun outdoor games for kids. See the Zipfy at http://www.dailygrommet.com DailyGrommet DailyGrommet adults child daily easy for freestyle fun game games gifts grommet kids kis lightweight luge mini outdoor racing safe sled sledding snow sport stable winter zipfy nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ OXO Candela Tooli Light Set - Fun for Kids and Kids Games Thu, 11 Dec 2008 23:52:35 -0800

Author: DailyGrommet
Added: Thu, 11 Dec 2008 23:52:35 -0800
Duration: 137

This child-safe, portable night light from OXO is a really bright idea. Great for kids who are afraid of the dark, late night trips to the potty, sleepovers and slumber parties, backyard camping, and playing games after lights out. The set includes LED lights with rechargeable batteries and charging base. The lights come in orange and fuchsia or blue and green.

]]> afraidbasecandelachargingchildchildrendailydarkforgamegrommetkidslampledlightnightnightmareoxoportablepottyrechargeablesafetyscaredsetterrortooli http://revver.com/video/1374303/oxo-candela-tooli-light-set-fun-for-kids-and-kids-games/ http://revver.com/watch/1374303 OXO Candela Tooli Light Set - Fun for Kids and Kids Games This child-safe, portable night light from OXO is a really bright idea. Great for kids who are afraid of the dark, late night trips to the potty, sleepovers and slumber parties, backyard camping, and playing games after lights out. The set includes LED lights with rechargeable batteries and charging base. The lights come in orange and fuchsia or blue and green. This child-safe, portable night light from OXO is a really bright idea. Great for kids who are afraid of the dark, late night trips to the potty, sleepovers and slumber parties, backyard camping, and playing games after lights out. The set includes LED lights with rechargeable batteries and charging base. The lights come in orange and fuchsia or blue and green. DailyGrommet DailyGrommet afraid base candela charging child children daily dark for game grommet kids lamp led light night nightmare oxo portable potty rechargeable safety scared set terror tooli nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Harvey & Strait Napkins - A perfect girlfriends gift idea Wed, 10 Dec 2008 20:31:50 -0800

Author: DailyGrommet
Added: Wed, 10 Dec 2008 20:31:50 -0800
Duration: 107

This set of six Harvey & Strait napkins makes a great gift idea for girlfriends, or a great addition to your own home. Napkins dress up your dinner table, and are truly eco-chic. These festive linens are an oversized 20" square, and can be machine washed and line dried (no ironing necessary). The Fiorenza red is a bold, beautiful print for the Christmas, or year-round cheer, and the Lisbon beige is more subtle for everyday. Your girlfriends will love this gift that will brighten up mealtimes for years to come. Come see why at Daily Grommet, http://www.dailygrommet.com

]]> &clothdailydiningdinnerforgiftgiftsgirlfriendgirlfriendsgrommetharveyholidayideaslinennapkinplaceplacematsettingstraittable http://revver.com/video/1371334/harvey-strait-napkins-a-perfect-girlfriends-gift-idea/ http://revver.com/watch/1371334 Harvey & Strait Napkins - A perfect girlfriends gift idea This set of six Harvey & Strait napkins makes a great gift idea for girlfriends, or a great addition to your own home. Napkins dress up your dinner table, and are truly eco-chic. These festive linens are an oversized 20" square, and can be machine washed and line dried (no ironing necessary). The Fiorenza red is a bold, beautiful print for the Christmas, or year-round cheer, and the Lisbon beige is more subtle for everyday. Your girlfriends will love this gift that will brighten up mealtimes for years to come. Come see why at Daily Grommet, http://www.dailygrommet.com This set of six Harvey & Strait napkins makes a great gift idea for girlfriends, or a great addition to your own home. Napkins dress up your dinner table, and are truly eco-chic. These festive linens are an oversized 20" square, and can be machine washed and line dried (no ironing necessary). The Fiorenza red is a bold, beautiful print for the Christmas, or year-round cheer, and the Lisbon beige is more subtle for everyday. Your girlfriends will love this gift that will brighten up mealtimes for years to come. Come see why at Daily Grommet, http://www.dailygrommet.com DailyGrommet DailyGrommet & cloth daily dining dinner for gift gifts girlfriend girlfriends grommet harvey holiday ideas linen napkin place placemat setting strait table nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Daily Grommet- Hear The Story Tue, 09 Dec 2008 17:52:39 -0800

Author: DailyGrommet
Added: Tue, 09 Dec 2008 17:52:39 -0800
Duration: 138

Our story is really simple...because it’s not about us. It’s about finding really fresh products and telling their stories. Those products, and their creators, and the people who love them (the products, that is) are the real heroes at Daily Grommet. The best part is, when we tell the story of a great product (or what we call a Grommet), people all over the world share the story, and help the Grommet get discovered, enjoyed, and dare we say, loved. Follow the Grommet story as it evolves, at www.dailygrommet.com

]]> bagschristmasclothingdailyforgiftsgirlfriendsgrommethandhandmadeindependentmademomproductspursesretailscarvestoys http://revver.com/video/1369280/daily-grommet-hear-the-story/ http://revver.com/watch/1369280 Daily Grommet- Hear The Story Our story is really simple...because it’s not about us. It’s about finding really fresh products and telling their stories. Those products, and their creators, and the people who love them (the products, that is) are the real heroes at Daily Grommet. The best part is, when we tell the story of a great product (or what we call a Grommet), people all over the world share the story, and help the Grommet get discovered, enjoyed, and dare we say, loved. Follow the Grommet story as it evolves, at www.dailygrommet.com Our story is really simple...because it’s not about us. It’s about finding really fresh products and telling their stories. Those products, and their creators, and the people who love them (the products, that is) are the real heroes at Daily Grommet. The best part is, when we tell the story of a great product (or what we call a Grommet), people all over the world share the story, and help the Grommet get discovered, enjoyed, and dare we say, loved. Follow the Grommet story as it evolves, at www.dailygrommet.com DailyGrommet DailyGrommet bags christmas clothing daily for gifts girlfriends grommet hand handmade independent made mom products purses retail scarves toys nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ 9 Manning Square Glass Hair Ties - Perfect girlfriends gift Tue, 09 Dec 2008 14:52:40 -0800

Author: DailyGrommet
Added: Tue, 09 Dec 2008 14:52:40 -0800
Duration: 126

These beautiful hair ties made from recycled glass are a great gift idea for girlfriends, or just enjoy them yourself. Includes 4 so you can even give some as gifts and keep some. Rhode Island artist Meg Reagan has acquired a celebrity following (including Paris Hilton) for her stylish designs. This set contains four hair ties featuring speckled glass in different colors. They'll make for perfectly elegant ponytails every time for you or a girlfriend. Visit http://www.dailygrommet.com

]]> 9 manning squareart glassartistdaily grommetfused glassgift ideas girlfriendgirlfriend giftsglasshairhair accessorieshair bandhair tiemeg reaganponytail holderpulled backrecycled glassrubber bandscrunchiesetspeckledstyle http://revver.com/video/1368873/9-manning-square-glass-hair-ties-perfect-girlfriends-gift/ http://revver.com/watch/1368873 9 Manning Square Glass Hair Ties - Perfect girlfriends gift These beautiful hair ties made from recycled glass are a great gift idea for girlfriends, or just enjoy them yourself. Includes 4 so you can even give some as gifts and keep some. Rhode Island artist Meg Reagan has acquired a celebrity following (including Paris Hilton) for her stylish designs. This set contains four hair ties featuring speckled glass in different colors. They'll make for perfectly elegant ponytails every time for you or a girlfriend. Visit http://www.dailygrommet.com These beautiful hair ties made from recycled glass are a great gift idea for girlfriends, or just enjoy them yourself. Includes 4 so you can even give some as gifts and keep some. Rhode Island artist Meg Reagan has acquired a celebrity following (including Paris Hilton) for her stylish designs. This set contains four hair ties featuring speckled glass in different colors. They'll make for perfectly elegant ponytails every time for you or a girlfriend. Visit http://www.dailygrommet.com DailyGrommet DailyGrommet 9 manning square art glass artist daily grommet fused glass gift ideas girlfriend girlfriend gifts glass hair hair accessories hair band hair tie meg reagan ponytail holder pulled back recycled glass rubber band scrunchie set speckled style nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ HaPe Quadrilla Marble Run Game for Kids Mon, 08 Dec 2008 19:49:48 -0800

Author: DailyGrommet
Added: Mon, 08 Dec 2008 19:49:48 -0800
Duration: 128

This wooden marble run construction kit is a great game for kids. Your whole family will want to help build and play with these marble runs. Kids can create ramps, funnels, and teeter totters. Includes wooden tracks, marbles, and a rainbow of wooden blocks, each with a different function. This game for kids would be a great gift idea, and it's heirloom-quality so it will last and last. Explore Quadrilla at http://www.dailygrommet.com

]]> constructiondailyeducationalforfunfunnelgamegrommethapekidsmarblequadrillaramprunsetteetertottertoytrackwooden http://revver.com/video/1366636/hape-quadrilla-marble-run-game-for-kids/ http://revver.com/watch/1366636 HaPe Quadrilla Marble Run Game for Kids This wooden marble run construction kit is a great game for kids. Your whole family will want to help build and play with these marble runs. Kids can create ramps, funnels, and teeter totters. Includes wooden tracks, marbles, and a rainbow of wooden blocks, each with a different function. This game for kids would be a great gift idea, and it's heirloom-quality so it will last and last. Explore Quadrilla at http://www.dailygrommet.com This wooden marble run construction kit is a great game for kids. Your whole family will want to help build and play with these marble runs. Kids can create ramps, funnels, and teeter totters. Includes wooden tracks, marbles, and a rainbow of wooden blocks, each with a different function. This game for kids would be a great gift idea, and it's heirloom-quality so it will last and last. Explore Quadrilla at http://www.dailygrommet.com DailyGrommet DailyGrommet construction daily educational for fun funnel game grommet hape kids marble quadrilla ramp run set teeter totter toy track wooden nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Hotcakes Design Carved Resin Necklace - Gift for Girlfriends Fri, 05 Dec 2008 13:52:36 -0800

Author: DailyGrommet
Added: Fri, 05 Dec 2008 13:52:36 -0800
Duration: 142

Find out why we're loving these bold, black retro-mod necklaces with pendants that feature whimsical vintage artwork. Beads are made of resin, prints of raven, a flower. The perfect gift for those hipster girlfriends, or treat yourself to this fabulous necklace from Hotcakes Design. Check it out at http://www.dailygrommet.com!

]]> 40sartworkbakeliteblackboldcaramiacarvedchunkydailydesignflowerforgiftgiftsgirlfriendsgrommethipsterhotcakesjewelrymodnecklacependantravenresinretrovintagewife http://revver.com/video/1361081/hotcakes-design-carved-resin-necklace-gift-for-girlfriends/ http://revver.com/watch/1361081 Hotcakes Design Carved Resin Necklace - Gift for Girlfriends Find out why we're loving these bold, black retro-mod necklaces with pendants that feature whimsical vintage artwork. Beads are made of resin, prints of raven, a flower. The perfect gift for those hipster girlfriends, or treat yourself to this fabulous necklace from Hotcakes Design. Check it out at http://www.dailygrommet.com! Find out why we're loving these bold, black retro-mod necklaces with pendants that feature whimsical vintage artwork. Beads are made of resin, prints of raven, a flower. The perfect gift for those hipster girlfriends, or treat yourself to this fabulous necklace from Hotcakes Design. Check it out at http://www.dailygrommet.com! DailyGrommet DailyGrommet 40s artwork bakelite black bold caramia carved chunky daily design flower for gift gifts girlfriends grommet hipster hotcakes jewelry mod necklace pendant raven resin retro vintage wife nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ thefoodloop -4 Silicone Trussing Tools Thu, 04 Dec 2008 19:52:36 -0800

Author: DailyGrommet
Added: Thu, 04 Dec 2008 19:52:36 -0800
Duration: 125

We love this food-safe silicone trussing tool from thefoodloop -- it's perfect for anyone who's lousy with twine and toothpicks. It makes preparing a roast, a chicken, turkey, or stuffed meats easy. There are four reusable loops per package. They're heat safe to 675F and they can go into the dishwasher when you're done. Find out more at http://www.dailygrommet.com

]]> birdschefchickencookdailyduckfoodiegadgetgizmogrommetkitchenmeatsroastssiliconestuffedthefoodlooptooltoothpickstrussingturkeytwinevegetables http://revver.com/video/1358966/thefoodloop-4-silicone-trussing-tools/ http://revver.com/watch/1358966 thefoodloop -4 Silicone Trussing Tools We love this food-safe silicone trussing tool from thefoodloop -- it's perfect for anyone who's lousy with twine and toothpicks. It makes preparing a roast, a chicken, turkey, or stuffed meats easy. There are four reusable loops per package. They're heat safe to 675F and they can go into the dishwasher when you're done. Find out more at http://www.dailygrommet.com We love this food-safe silicone trussing tool from thefoodloop -- it's perfect for anyone who's lousy with twine and toothpicks. It makes preparing a roast, a chicken, turkey, or stuffed meats easy. There are four reusable loops per package. They're heat safe to 675F and they can go into the dishwasher when you're done. Find out more at http://www.dailygrommet.com DailyGrommet DailyGrommet birds chef chicken cook daily duck foodie gadget gizmo grommet kitchen meats roasts silicone stuffed thefoodloop tool toothpicks trussing turkey twine vegetables nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ America at Home Photographic Journal Wed, 03 Dec 2008 22:52:47 -0800

Author: DailyGrommet
Added: Wed, 03 Dec 2008 22:52:47 -0800
Duration: 162

Discover an extraordinary photographic journal called America at Home. It's the perfect holiday gift, with fascinating pictures from 100 of the nation's leading photojournalists plus thousands of amateurs, along with essays from Amy Tan, Matt Groening and others, capturing the emotions of the American home. But best yet, you can personalize the cover of the book with your own personal snapshot to show off your own children, family and pets!

]]> americaamericanamyartatbookchildrencoffeecoverdailyfamilygiftgiftsgroeninggrommetholidayhomejacketjournalmattpersonalizedpetsphotographicphotographypicturericksmolantabletan http://revver.com/video/1357399/america-at-home-photographic-journal/ http://revver.com/watch/1357399 America at Home Photographic Journal Discover an extraordinary photographic journal called America at Home. It's the perfect holiday gift, with fascinating pictures from 100 of the nation's leading photojournalists plus thousands of amateurs, along with essays from Amy Tan, Matt Groening and others, capturing the emotions of the American home. But best yet, you can personalize the cover of the book with your own personal snapshot to show off your own children, family and pets! Discover an extraordinary photographic journal called America at Home. It's the perfect holiday gift, with fascinating pictures from 100 of the nation's leading photojournalists plus thousands of amateurs, along with essays from Amy Tan, Matt Groening and others, capturing the emotions of the American home. But best yet, you can personalize the cover of the book with your own personal snapshot to show off your own children, family and pets! DailyGrommet DailyGrommet america american amy art at book children coffee cover daily family gift gifts groening grommet holiday home jacket journal matt personalized pets photographic photography picture rick smolan table tan nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ America at Home Photographic Journal Wed, 03 Dec 2008 20:33:20 -0800

Author: DailyGrommet
Added: Wed, 03 Dec 2008 20:33:20 -0800
Duration: 162

Discover an extraordinary photographic journal called America at Home. It's the perfect holiday gift, with fascinating pictures from 100 of the nation's leading photojournalists plus thousands of amateurs, along with essays from Amy Tan, Matt Groening and others, capturing the emotions of the American home. But best yet, you can personalize the cover of the book with your own personal snapshot to show off your own children, family and pets! Hear the full story at www.dailygrommet.com

]]> americaamericanamyartatbookchildrencoffeecoverdailyfamilygiftgiftsgroeninggrommetholidayhomeindependentjacketjournalmattpersonalizedpetsphotophotographicphotographypicturetabletan http://revver.com/video/1356863/america-at-home-photographic-journal/ http://revver.com/watch/1356863 America at Home Photographic Journal Discover an extraordinary photographic journal called America at Home. It's the perfect holiday gift, with fascinating pictures from 100 of the nation's leading photojournalists plus thousands of amateurs, along with essays from Amy Tan, Matt Groening and others, capturing the emotions of the American home. But best yet, you can personalize the cover of the book with your own personal snapshot to show off your own children, family and pets! Hear the full story at www.dailygrommet.com Discover an extraordinary photographic journal called America at Home. It's the perfect holiday gift, with fascinating pictures from 100 of the nation's leading photojournalists plus thousands of amateurs, along with essays from Amy Tan, Matt Groening and others, capturing the emotions of the American home. But best yet, you can personalize the cover of the book with your own personal snapshot to show off your own children, family and pets! Hear the full story at www.dailygrommet.com DailyGrommet DailyGrommet america american amy art at book children coffee cover daily family gift gifts groening grommet holiday home independent jacket journal matt personalized pets photo photographic photography picture table tan nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ HABA Wooden Play Scale Tue, 02 Dec 2008 17:49:51 -0800

Author: DailyGrommet
Added: Tue, 02 Dec 2008 17:49:51 -0800
Duration: 125

This heirloom-quality wooden toy scale from HABA is the perfect present for curious little kids. Children measure, weigh, learn math skills - great gift for kids from toddlers and kids three, four, or five and up. Daily Grommet is a fan of non-battery toys that last and are clever like this!

]]> balancebeechwoodchildrendailyfivefourgermangiftgrommethabahandcraftedheirloomindependentmeasureplayproductproductsscalethreetoddlertoyupweighwood http://revver.com/video/1354680/haba-wooden-play-scale/ http://revver.com/watch/1354680 HABA Wooden Play Scale This heirloom-quality wooden toy scale from HABA is the perfect present for curious little kids. Children measure, weigh, learn math skills - great gift for kids from toddlers and kids three, four, or five and up. Daily Grommet is a fan of non-battery toys that last and are clever like this! This heirloom-quality wooden toy scale from HABA is the perfect present for curious little kids. Children measure, weigh, learn math skills - great gift for kids from toddlers and kids three, four, or five and up. Daily Grommet is a fan of non-battery toys that last and are clever like this! DailyGrommet DailyGrommet balance beechwood children daily five four german gift grommet haba handcrafted heirloom independent measure play product products scale three toddler toy up weigh wood nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Tea Fort Holiday Tree Sampler Mon, 01 Dec 2008 18:52:36 -0800

Author: DailyGrommet
Added: Mon, 01 Dec 2008 18:52:36 -0800
Duration: 137

See why we love this Christmas-tree shaped box from Tea Fort, loaded with an assortment of tea that's beautiful to look at and delicious to drink. It's the perfect holiday gift for the tea lover on your list, with delicious flavors like crimson nectar and English breakfast. Daily Grommet is such a fan of the signature Tea Fort pyramid shaped silken tea infusers, and we know tea drinkers will agree that this tea sampler is just the right gift to give.

]]> bagbreakfastchrismascollectioncrimsondailydrinkerenglishfortgiftgrommetholidayindependentinfuserlovernectarorangeproductproductspyramidsamplersilkenspicesweetteatree http://revver.com/video/1352407/tea-fort-holiday-tree-sampler/ http://revver.com/watch/1352407 Tea Fort Holiday Tree Sampler See why we love this Christmas-tree shaped box from Tea Fort, loaded with an assortment of tea that's beautiful to look at and delicious to drink. It's the perfect holiday gift for the tea lover on your list, with delicious flavors like crimson nectar and English breakfast. Daily Grommet is such a fan of the signature Tea Fort pyramid shaped silken tea infusers, and we know tea drinkers will agree that this tea sampler is just the right gift to give. See why we love this Christmas-tree shaped box from Tea Fort, loaded with an assortment of tea that's beautiful to look at and delicious to drink. It's the perfect holiday gift for the tea lover on your list, with delicious flavors like crimson nectar and English breakfast. Daily Grommet is such a fan of the signature Tea Fort pyramid shaped silken tea infusers, and we know tea drinkers will agree that this tea sampler is just the right gift to give. DailyGrommet DailyGrommet bag breakfast chrismas collection crimson daily drinker english fort gift grommet holiday independent infuser lover nectar orange product products pyramid sampler silken spice sweet tea tree nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ JL Lane Evening Clutch Fri, 28 Nov 2008 22:52:43 -0800

Author: DailyGrommet
Added: Fri, 28 Nov 2008 22:52:43 -0800
Duration: 134

These heirloom-quality bags are from the expert craftswomen of Vietnam. This is a feel good, look good product! Discover why we love these handbags that give back.

]]> bulletclutchdailyembroideredeveninggrommethandbaghandmadeindependentjllaneproductproductspursevietnam http://revver.com/video/1347255/jl-lane-evening-clutch/ http://revver.com/watch/1347255 JL Lane Evening Clutch These heirloom-quality bags are from the expert craftswomen of Vietnam. This is a feel good, look good product! Discover why we love these handbags that give back. These heirloom-quality bags are from the expert craftswomen of Vietnam. This is a feel good, look good product! Discover why we love these handbags that give back. DailyGrommet DailyGrommet bullet clutch daily embroidered evening grommet handbag handmade independent jl lane product products purse vietnam nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bebe au Lait Nursing Cover Thu, 27 Nov 2008 17:52:33 -0800

Author: DailyGrommet
Added: Thu, 27 Nov 2008 17:52:33 -0800
Duration: 123

A handy cover to help you nurse Baby discretely. And you'll love all the beautiful prints!

]]> aubabybebeblanketbreastbreastfeedingcoverdailydiscretefeedinggrommethidehidershooterhowlaitnipplenursingto http://revver.com/video/1345426/bebe-au-lait-nursing-cover/ http://revver.com/watch/1345426 Bebe au Lait Nursing Cover A handy cover to help you nurse Baby discretely. And you'll love all the beautiful prints! A handy cover to help you nurse Baby discretely. And you'll love all the beautiful prints! DailyGrommet DailyGrommet au baby bebe blanket breast breastfeeding cover daily discrete feeding grommet hide hiders hooter how lait nipple nursing to nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Nutrabella Bellybar Sampler Pack Wed, 26 Nov 2008 19:52:36 -0800

Author: DailyGrommet
Added: Wed, 26 Nov 2008 19:52:36 -0800
Duration: 123

Find out why moms-to-be are loving these prenatal nutrient-packed bars, shakes, and chew.

]]> acidbarbellybarcantchewdailyfolatefolicgrommetmorningnutrabellanutrientnutritionprenatalrequirementsshakesicknessswallowtreatvitamin http://revver.com/video/1343007/nutrabella-bellybar-sampler-pack/ http://revver.com/watch/1343007 Nutrabella Bellybar Sampler Pack Find out why moms-to-be are loving these prenatal nutrient-packed bars, shakes, and chew. Find out why moms-to-be are loving these prenatal nutrient-packed bars, shakes, and chew. DailyGrommet DailyGrommet acid bar bellybar cant chew daily folate folic grommet morning nutrabella nutrient nutrition prenatal requirements shake sickness swallow treat vitamin nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ House of Buff Multifunctional Headwear Tue, 25 Nov 2008 15:52:32 -0800

Author: DailyGrommet
Added: Tue, 25 Nov 2008 15:52:32 -0800
Duration: 114

Discover this new concept in cold weather gear that's become a must-have accessory in our homes.

]]> balaclavabandbuffdailyearearsfleecegeargrommethatheadheadbandheadwearmaskmuffsneckpolarfleecescarfskithermalwarmwinter http://revver.com/video/1340716/house-of-buff-multifunctional-headwear/ http://revver.com/watch/1340716 House of Buff Multifunctional Headwear Discover this new concept in cold weather gear that's become a must-have accessory in our homes. Discover this new concept in cold weather gear that's become a must-have accessory in our homes. DailyGrommet DailyGrommet balaclava band buff daily ear ears fleece gear grommet hat head headband headwear mask muffs neck polarfleece scarf ski thermal warm winter nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ We Are Fishermen Jesus Figurines Mon, 24 Nov 2008 18:52:36 -0800

Author: DailyGrommet
Added: Mon, 24 Nov 2008 18:52:36 -0800
Duration: 121

Find out why we love these fascinating Jesus figurines. These cheerful figurines are one of our favorite ndependent products!

]]> artcatholicchristchristiancrowndailygiftgrommetindependentjesuslordproductsprotestantrobesstatuethorns http://revver.com/video/1338385/we-are-fishermen-jesus-figurines/ http://revver.com/watch/1338385 We Are Fishermen Jesus Figurines Find out why we love these fascinating Jesus figurines. These cheerful figurines are one of our favorite ndependent products! Find out why we love these fascinating Jesus figurines. These cheerful figurines are one of our favorite ndependent products! DailyGrommet DailyGrommet art catholic christ christian crown daily gift grommet independent jesus lord products protestant robes statue thorns nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Marmalade Ink Custom Holiday Cards Fri, 21 Nov 2008 18:49:46 -0800

Author: DailyGrommet
Added: Fri, 21 Nov 2008 18:49:46 -0800
Duration: 132

We're loving this holiday card company that lets you get creative with double-sided printing and up to eight pictures for the same price

]]> backcardschristmascustomdailydouble-sidedfamilyfrontgrommetholidayinkmarmaladenewphotopicturesprintingstationeryyear http://revver.com/video/1332907/marmalade-ink-custom-holiday-cards/ http://revver.com/watch/1332907 Marmalade Ink Custom Holiday Cards We're loving this holiday card company that lets you get creative with double-sided printing and up to eight pictures for the same price We're loving this holiday card company that lets you get creative with double-sided printing and up to eight pictures for the same price DailyGrommet DailyGrommet back cards christmas custom daily double-sided family front grommet holiday ink marmalade new photo pictures printing stationery year nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Constructive Eating 3-Piece Utensil Set Thu, 20 Nov 2008 22:52:33 -0800

Author: DailyGrommet
Added: Thu, 20 Nov 2008 22:52:33 -0800
Duration: 115

Discover this playful set of children's utensils that might just be the answer to dinnertime chaos.

]]> constructionconstructivedailydinnereatingfivefoodsforkfourfungrommetoldpbasphalate-freeplasticpusherpvcrubbersafesolidspoonthreetoolsutensilsyear http://revver.com/video/1330514/constructive-eating-3-piece-utensil-set/ http://revver.com/watch/1330514 Constructive Eating 3-Piece Utensil Set Discover this playful set of children's utensils that might just be the answer to dinnertime chaos. Discover this playful set of children's utensils that might just be the answer to dinnertime chaos. DailyGrommet DailyGrommet construction constructive daily dinner eating five foods fork four fun grommet old pbas phalate-free plastic pusher pvc rubber safe solid spoon three tools utensils year nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Superfeet High Heel Comfort Insoles Wed, 19 Nov 2008 20:33:18 -0800

Author: DailyGrommet
Added: Wed, 19 Nov 2008 20:33:18 -0800
Duration: 127

These amazing insoles could make your pinchiest pair of heels painless.

]]> acheblisterchoocomfortdailygrommetheelhighinsolejimmymanolopinchplatformpodiatristpreventpumpshoesuperfeetwalk http://revver.com/video/1328420/superfeet-high-heel-comfort-insoles/ http://revver.com/watch/1328420 Superfeet High Heel Comfort Insoles These amazing insoles could make your pinchiest pair of heels painless. These amazing insoles could make your pinchiest pair of heels painless. DailyGrommet DailyGrommet ache blister choo comfort daily grommet heel high insole jimmy manolo pinch platform podiatrist prevent pump shoe superfeet walk nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Heelarious Crib Shoes Tue, 18 Nov 2008 14:49:41 -0800

Author: DailyGrommet
Added: Tue, 18 Nov 2008 14:49:41 -0800
Duration: 109

Check out these wild high-heeled crib shoes for Baby! If you want to be the person at a baby shower with the coolest gift, these crib shoes are they way to go. They're soft, safe, and fun.

]]> babycostumecribdailydressfunnygiftgrommetheelheelarioushighinfantshoeup http://revver.com/video/1326156/heelarious-crib-shoes/ http://revver.com/watch/1326156 Heelarious Crib Shoes Check out these wild high-heeled crib shoes for Baby! If you want to be the person at a baby shower with the coolest gift, these crib shoes are they way to go. They're soft, safe, and fun. Check out these wild high-heeled crib shoes for Baby! If you want to be the person at a baby shower with the coolest gift, these crib shoes are they way to go. They're soft, safe, and fun. DailyGrommet DailyGrommet baby costume crib daily dress funny gift grommet heel heelarious high infant shoe up nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Laundry Tree Soapnuts Starter Pack Mon, 17 Nov 2008 16:33:21 -0800

Author: DailyGrommet
Added: Mon, 17 Nov 2008 16:33:21 -0800
Duration: 180

Find out why these bags of natural soapnuts are the best all-natural laundry product you've probably never heard of!

]]> babyberrybiodegradablechilddailydetergentecoeczemagreengrommetindiaindonesialaundryorganicrashsaponinsensitiveshellskinsoapnutstree http://revver.com/video/1323978/laundry-tree-soapnuts-starter-pack/ http://revver.com/watch/1323978 Laundry Tree Soapnuts Starter Pack Find out why these bags of natural soapnuts are the best all-natural laundry product you've probably never heard of! Find out why these bags of natural soapnuts are the best all-natural laundry product you've probably never heard of! DailyGrommet DailyGrommet baby berry biodegradable child daily detergent eco eczema green grommet india indonesia laundry organic rash saponin sensitive shell skin soapnuts tree nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ One Laptop Per Child Sat, 15 Nov 2008 11:52:38 -0800

Author: DailyGrommet
Added: Sat, 15 Nov 2008 11:52:38 -0800
Duration: 168

Find out more about this amazing promotion from the One Laptop Per Child Foundation. Give a laptop, get a laptop, change the world!

]]> batterycamerachildcomputercountrycrankdailydevelopinggamesglobalgrommethandkidlaptopmeshmoviemusicnetworkoneperprocessingruggedsolarvideowordxo http://revver.com/video/1316511/one-laptop-per-child/ http://revver.com/watch/1316511 One Laptop Per Child Find out more about this amazing promotion from the One Laptop Per Child Foundation. Give a laptop, get a laptop, change the world! Find out more about this amazing promotion from the One Laptop Per Child Foundation. Give a laptop, get a laptop, change the world! DailyGrommet DailyGrommet battery camera child computer country crank daily developing games global grommet hand kid laptop mesh movie music network one per processing rugged solar video word xo nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Kathy Stamou Handcrafted Necklace and Earring Set Fri, 14 Nov 2008 11:52:35 -0800

Author: DailyGrommet
Added: Fri, 14 Nov 2008 11:52:35 -0800
Duration: 130

Discover a funky necklace and earring set made from washers and Spanish thread. Really!

]]> crafteddailyearringsfunkygrommethandirelandjewelrykathienecklacespanishstamouthreadwasher http://revver.com/video/1314539/kathy-stamou-handcrafted-necklace-and-earring-set/ http://revver.com/watch/1314539 Kathy Stamou Handcrafted Necklace and Earring Set Discover a funky necklace and earring set made from washers and Spanish thread. Really! Discover a funky necklace and earring set made from washers and Spanish thread. Really! DailyGrommet DailyGrommet crafted daily earrings funky grommet hand ireland jewelry kathie necklace spanish stamou thread washer nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Polka Dot Papoose Baby Sling Wed, 12 Nov 2008 16:33:05 -0800

Author: DailyGrommet
Added: Wed, 12 Nov 2008 16:33:05 -0800
Duration: 128

Take a look at this new Polka Dot Papoose Baby Sling at Dailygrommet.com. Tara Haramf's new sling is soft, stylish and safe!

]]> babybackpackdailydailygrommetdotgrommetpapoosepolkasilksling http://revver.com/video/1312829/polka-dot-papoose-baby-sling/ http://revver.com/watch/1312829 Polka Dot Papoose Baby Sling Take a look at this new Polka Dot Papoose Baby Sling at Dailygrommet.com. Tara Haramf's new sling is soft, stylish and safe! Take a look at this new Polka Dot Papoose Baby Sling at Dailygrommet.com. Tara Haramf's new sling is soft, stylish and safe! DailyGrommet DailyGrommet baby backpack daily dailygrommet dot grommet papoose polka silk sling nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Kiki & Polly Customized Portrait Art Tue, 11 Nov 2008 14:34:06 -0800

Author: DailyGrommet
Added: Tue, 11 Nov 2008 14:34:06 -0800
Duration: 115

Artist Lisa Golightly inserts photos of your children or loved ones into pre-existing or custom designs. Check out the beautiful portraits she creates using archive quality inks and acrylics on canvas.

]]> acrylicarchiveartistcustomcustomizeddailydesignfamilygiftgolightlygrommetholidayinkkikilisaoregonpainterphotopollyportlandportraitquality http://revver.com/video/1311205/kiki-polly-customized-portrait-art/ http://revver.com/watch/1311205 Kiki & Polly Customized Portrait Art Artist Lisa Golightly inserts photos of your children or loved ones into pre-existing or custom designs. Check out the beautiful portraits she creates using archive quality inks and acrylics on canvas. Artist Lisa Golightly inserts photos of your children or loved ones into pre-existing or custom designs. Check out the beautiful portraits she creates using archive quality inks and acrylics on canvas. DailyGrommet DailyGrommet acrylic archive artist custom customized daily design family gift golightly grommet holiday ink kiki lisa oregon painter photo polly portland portrait quality nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ iSi Flex It Measuring Cup Set Mon, 10 Nov 2008 12:35:38 -0800

Author: DailyGrommet
Added: Mon, 10 Nov 2008 12:35:38 -0800
Duration: 100

Discover a brand new kind of measuring cup that's different from anything you've seen before. We promise.

]]> bakecookcupdailyflexgommetisiitmeasuringnon-toxicplasticpoursetsilicone http://revver.com/video/1309368/isi-flex-it-measuring-cup-set/ http://revver.com/watch/1309368 iSi Flex It Measuring Cup Set Discover a brand new kind of measuring cup that's different from anything you've seen before. We promise. Discover a brand new kind of measuring cup that's different from anything you've seen before. We promise. DailyGrommet DailyGrommet bake cook cup daily flex gommet isi it measuring non-toxic plastic pour set silicone nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Oop Doo Hug Fri, 07 Nov 2008 11:54:44 -0800

Author: DailyGrommet
Added: Fri, 07 Nov 2008 11:54:44 -0800
Duration: 122

Daily Grommet Presents the Oop Doo Hug. This bandage-shaped wrap is a mommy must-have for times when your child needs more than first aid.

]]> aidband-aidbandageblanketchildcoldconsoledailydooempathyfirstfleecegrommethothugillnessinjurykatherineklingeroopoopdoopacksadsicksympathy http://revver.com/video/1305108/oop-doo-hug/ http://revver.com/watch/1305108 Oop Doo Hug Daily Grommet Presents the Oop Doo Hug. This bandage-shaped wrap is a mommy must-have for times when your child needs more than first aid. Daily Grommet Presents the Oop Doo Hug. This bandage-shaped wrap is a mommy must-have for times when your child needs more than first aid. DailyGrommet DailyGrommet aid band-aid bandage blanket child cold console daily doo empathy first fleece grommet hot hug illness injury katherine klinger oop oopdoo pack sad sick sympathy nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Caught Red Handed Belt Buckle Thu, 06 Nov 2008 12:35:29 -0800

Author: DailyGrommet
Added: Thu, 06 Nov 2008 12:35:29 -0800
Duration: 102

Check out these belt buckles with original artwork by Amy Galon that are colorful and eye-catching (in the very best way).

]]> amyartbeltbucklecandycaughtcolordailygalongrommethandedoriginalpatternredsilverwaist http://revver.com/video/1302999/caught-red-handed-belt-buckle/ http://revver.com/watch/1302999 Caught Red Handed Belt Buckle Check out these belt buckles with original artwork by Amy Galon that are colorful and eye-catching (in the very best way). Check out these belt buckles with original artwork by Amy Galon that are colorful and eye-catching (in the very best way). DailyGrommet DailyGrommet amy art belt buckle candy caught color daily galon grommet handed original pattern red silver waist nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Taking Things Seriously Essay Collection Wed, 05 Nov 2008 20:35:24 -0800

Author: DailyGrommet
Added: Wed, 05 Nov 2008 20:35:24 -0800
Duration: 119

Discover an essay collection called Taking Things Seriously: 75 Objects with Unexpected Significance, a celebration of stuff by the folks who've grown attached to it.

]]> 75bookcaroldailyessayglenngrommethayesjoshuaobjectobjectsphotographspossessionprizedseriouslysignificancetakingthingstrinketunexpectedwith http://revver.com/video/1300887/taking-things-seriously-essay-collection/ http://revver.com/watch/1300887 Taking Things Seriously Essay Collection Discover an essay collection called Taking Things Seriously: 75 Objects with Unexpected Significance, a celebration of stuff by the folks who've grown attached to it. Discover an essay collection called Taking Things Seriously: 75 Objects with Unexpected Significance, a celebration of stuff by the folks who've grown attached to it. DailyGrommet DailyGrommet 75 book carol daily essay glenn grommet hayes joshua object objects photographs possession prized seriously significance taking things trinket unexpected with nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ CARES Kids Fly Safe Air Travel Safety Restraint Tue, 04 Nov 2008 15:43:13 -0800

Author: DailyGrommet
Added: Tue, 04 Nov 2008 15:43:13 -0800
Duration: 117

Find out why moms are loving this lightweight car seat-alternative when flyng with kids under five.

]]> airairlineairplanecarcareschilddailyflygrommetharnesskidsplanerestraintsafesafetyseattravel http://revver.com/video/1298518/cares-kids-fly-safe-air-travel-safety-restraint/ http://revver.com/watch/1298518 CARES Kids Fly Safe Air Travel Safety Restraint Find out why moms are loving this lightweight car seat-alternative when flyng with kids under five. Find out why moms are loving this lightweight car seat-alternative when flyng with kids under five. DailyGrommet DailyGrommet air airline airplane car cares child daily fly grommet harness kids plane restraint safe safety seat travel nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Couleur Nature Table Runner Tue, 04 Nov 2008 12:48:28 -0800

Author: DailyGrommet
Added: Tue, 04 Nov 2008 12:48:28 -0800
Duration: 123

Discover a very pretty (and surprisingly practical) way to dress up your dining table. Daily Grommet explains the Couleur Nature Table Runner.

]]> blockedcoleurdailydecordecorativediningfamilyfrancefrenchgrommethandnatureroomrunnertabletablecloth http://revver.com/video/1296344/couleur-nature-table-runner/ http://revver.com/watch/1296344 Couleur Nature Table Runner Discover a very pretty (and surprisingly practical) way to dress up your dining table. Daily Grommet explains the Couleur Nature Table Runner. Discover a very pretty (and surprisingly practical) way to dress up your dining table. Daily Grommet explains the Couleur Nature Table Runner. DailyGrommet DailyGrommet blocked coleur daily decor decorative dining family france french grommet hand nature room runner table tablecloth nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Kipiis Bib Clips Fri, 31 Oct 2008 12:36:24 -0800

Author: DailyGrommet
Added: Fri, 31 Oct 2008 12:36:24 -0800
Duration: 63

Discover a new product that turns anything into a bib: a napkin, a paper towel, a washcloth, anything!

]]> babiesbabybibcleanclipsdailyfeedingfoodgrommethandykipiismommyneatpaperrestaurantsolidstrollertoweltravel http://revver.com/video/1290917/kipiis-bib-clips/ http://revver.com/watch/1290917 Kipiis Bib Clips Discover a new product that turns anything into a bib: a napkin, a paper towel, a washcloth, anything! Discover a new product that turns anything into a bib: a napkin, a paper towel, a washcloth, anything! DailyGrommet DailyGrommet babies baby bib clean clips daily feeding food grommet handy kipiis mommy neat paper restaurant solid stroller towel travel nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Daily Grommet: Brooke Stanton Scarf Thu, 30 Oct 2008 13:55:30 -0800

Author: DailyGrommet
Added: Thu, 30 Oct 2008 13:55:30 -0800
Duration: 115

Find out why we love this colorful hand-dyed scarf.

]]> accessorybrookecolordailydyedgiftgrommethandhowscarfscarvessilkstantontietounique http://revver.com/video/1288710/daily-grommet-brooke-stanton-scarf/ http://revver.com/watch/1288710 Daily Grommet: Brooke Stanton Scarf Find out why we love this colorful hand-dyed scarf. Find out why we love this colorful hand-dyed scarf. DailyGrommet DailyGrommet accessory brooke color daily dyed gift grommet hand how scarf scarves silk stanton tie to unique nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Tea Fort Autumn Sampler Collection Wed, 29 Oct 2008 19:55:27 -0800

Author: DailyGrommet
Added: Wed, 29 Oct 2008 19:55:27 -0800
Duration: 83

You've never seen anything like these gorgeous tea infusers. Tea Fort is much prettier than traditional tea (and tastes better, too).

]]> autumnbagbrewedceremonycollectiondailyfortegrommethewittinfuserjapanesepetersamplertea http://revver.com/video/1286687/tea-fort-autumn-sampler-collection/ http://revver.com/watch/1286687 Tea Fort Autumn Sampler Collection You've never seen anything like these gorgeous tea infusers. Tea Fort is much prettier than traditional tea (and tastes better, too). You've never seen anything like these gorgeous tea infusers. Tea Fort is much prettier than traditional tea (and tastes better, too). DailyGrommet DailyGrommet autumn bag brewed ceremony collection daily forte grommet hewitt infuser japanese peter sampler tea nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Hanky Panky Thong Panty Tue, 28 Oct 2008 18:52:18 -0800

Author: DailyGrommet
Added: Tue, 28 Oct 2008 18:52:18 -0800
Duration: 134

Through some phenomenal feat of lingerie engineering, this thong fits… all of us. It looks good under clothes (no visible panty lines, no creeping up above the waistband), and it feels good.

]]> allfitshankyonepankypantylinepantylinessizethongunderwear http://revver.com/video/1284591/hanky-panky-thong-panty/ http://revver.com/watch/1284591 Hanky Panky Thong Panty Through some phenomenal feat of lingerie engineering, this thong fits… all of us. It looks good under clothes (no visible panty lines, no creeping up above the waistband), and it feels good. Through some phenomenal feat of lingerie engineering, this thong fits… all of us. It looks good under clothes (no visible panty lines, no creeping up above the waistband), and it feels good. DailyGrommet DailyGrommet all fits hanky one panky pantyline pantylines size thong underwear nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ B Designs List Maker Caddy Mon, 27 Oct 2008 14:55:10 -0800

Author: DailyGrommet
Added: Mon, 27 Oct 2008 14:55:10 -0800
Duration: 113

Find out why we love this adorable stationery caddy that's perfect for compulsive list makers everywhere!

]]> bcaddydailydesignsdogrommethoneylistmakermessagenotecardshoppingslipstationerytaketo http://revver.com/video/1282220/b-designs-list-maker-caddy/ http://revver.com/watch/1282220 B Designs List Maker Caddy Find out why we love this adorable stationery caddy that's perfect for compulsive list makers everywhere! Find out why we love this adorable stationery caddy that's perfect for compulsive list makers everywhere! DailyGrommet DailyGrommet b caddy daily designs do grommet honey list maker message notecard shopping slip stationery take to nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Daily Grommet: Microplane Zester/Grater Fri, 24 Oct 2008 18:54:55 -0800

Author: DailyGrommet
Added: Fri, 24 Oct 2008 18:54:55 -0800
Duration: 129

Daily Grommet presents the Microplane Zester/Grater. The Microplane Zester/Grater is a hot kitchen tool that actually started as a carpenter's rasp.

]]> cheesecookingdailyfoodiegadgetgiftgourmetgratergrommetmicroplanetoolzestzester http://revver.com/video/1277335/daily-grommet-microplane-zestergrater/ http://revver.com/watch/1277335 Daily Grommet: Microplane Zester/Grater Daily Grommet presents the Microplane Zester/Grater. The Microplane Zester/Grater is a hot kitchen tool that actually started as a carpenter's rasp. Daily Grommet presents the Microplane Zester/Grater. The Microplane Zester/Grater is a hot kitchen tool that actually started as a carpenter's rasp. DailyGrommet DailyGrommet cheese cooking daily foodie gadget gift gourmet grater grommet microplane tool zest zester nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Daily Grommet: Mrs. Meyer's Clean Day Basil Collection Fri, 24 Oct 2008 13:54:49 -0800

Author: DailyGrommet
Added: Fri, 24 Oct 2008 13:54:49 -0800
Duration: 127

Discover why we're loving these natural and fabulous smelling cleaning products from Mrs. Meyer's Clean Day.

]]> allbasilcleancleaningcleansersdailydayessentialfragrancefreshgrommetmeyersmrsoilproductpurposescentscrub http://revver.com/video/1276599/daily-grommet-mrs-meyers-clean-day-basil-collection/ http://revver.com/watch/1276599 Daily Grommet: Mrs. Meyer's Clean Day Basil Collection Discover why we're loving these natural and fabulous smelling cleaning products from Mrs. Meyer's Clean Day. Discover why we're loving these natural and fabulous smelling cleaning products from Mrs. Meyer's Clean Day. DailyGrommet DailyGrommet all basil clean cleaning cleansers daily day essential fragrance fresh grommet meyers mrs oil product purpose scent scrub nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Daily Grommet: Microplane Zester/Grater Thu, 23 Oct 2008 17:54:45 -0800

Author: DailyGrommet
Added: Thu, 23 Oct 2008 17:54:45 -0800
Duration: 129

The Microplane Zester/Grater is a hot kitchen tool that actually started as a carpenter's rasp.

]]> cheesecookingdaily grommetfoodiegadgetgiftgourmetgratermicroplanetoolzestzester http://revver.com/video/1274456/daily-grommet-microplane-zestergrater/ http://revver.com/watch/1274456 Daily Grommet: Microplane Zester/Grater The Microplane Zester/Grater is a hot kitchen tool that actually started as a carpenter's rasp. The Microplane Zester/Grater is a hot kitchen tool that actually started as a carpenter's rasp. DailyGrommet DailyGrommet cheese cooking daily grommet foodie gadget gift gourmet grater microplane tool zest zester nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Daily Grommet: Imyu Fiberwig Mascara Wed, 22 Oct 2008 13:54:35 -0800

Author: DailyGrommet
Added: Wed, 22 Oct 2008 13:54:35 -0800
Duration: 119

Daily Grommet presents Imyu Fiberwig Mascara. Find out more about this Japanese mascara that's becoming a cult favorite in the USA. Silly name, amazing mascara!

]]> daily grommeteyelasheyelashesfake eyelashesfiberwiggrommetimyujapaneselengtheningmascarano flakesthickening http://revver.com/video/1268209/daily-grommet-imyu-fiberwig-mascara/ http://revver.com/watch/1268209 Daily Grommet: Imyu Fiberwig Mascara Daily Grommet presents Imyu Fiberwig Mascara. Find out more about this Japanese mascara that's becoming a cult favorite in the USA. Silly name, amazing mascara! Daily Grommet presents Imyu Fiberwig Mascara. Find out more about this Japanese mascara that's becoming a cult favorite in the USA. Silly name, amazing mascara! DailyGrommet DailyGrommet daily grommet eyelash eyelashes fake eyelashes fiberwig grommet imyu japanese lengthening mascara no flakes thickening nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Daily Grommet: Bunnytail Blanket Tue, 21 Oct 2008 13:54:30 -0800

Author: DailyGrommet
Added: Tue, 21 Oct 2008 13:54:30 -0800
Duration: 144

Jogging stroller warmer, baby lovey, superhero cape—this awesome indoor-outdoor blanket can really do it all.

]]> babyblanketblanketsbunnytailjoy pratt shiffmanoutdoorpolar fleecestrollerwater repellentwind repellent http://revver.com/video/1265933/daily-grommet-bunnytail-blanket/ http://revver.com/watch/1265933 Daily Grommet: Bunnytail Blanket Jogging stroller warmer, baby lovey, superhero cape—this awesome indoor-outdoor blanket can really do it all. Jogging stroller warmer, baby lovey, superhero cape—this awesome indoor-outdoor blanket can really do it all. DailyGrommet DailyGrommet baby blanket blankets bunnytail joy pratt shiffman outdoor polar fleece stroller water repellent wind repellent nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/