Videos by HotNewzTV Videos by HotNewzTV http://revver.com/u/HotNewzTV/ http://revver.com webmaster@revver.com Girls Fight Back: Outside Door Sat, 24 Oct 2009 15:52:33 -0800

Author: HotNewzTV
Added: Sat, 24 Oct 2009 15:52:33 -0800
Duration: 0

If you see someone creepy standing behind you while you're trying to get into your home, resist the urge to run inside. Girls Fight Back expert Erin Weed tells us why. Distributed by Tubemogul.

]]> attackerbackerinfightgirlsgirlsfightbackorghnexperthomeinvasionoutsidepublicsafetyweed http://revver.com/video/1560202/girls-fight-back-outside-door/ http://revver.com/watch/1560202 Girls Fight Back: Outside Door If you see someone creepy standing behind you while you're trying to get into your home, resist the urge to run inside. Girls Fight Back expert Erin Weed tells us why. Distributed by Tubemogul. If you see someone creepy standing behind you while you're trying to get into your home, resist the urge to run inside. Girls Fight Back expert Erin Weed tells us why. Distributed by Tubemogul. HotNewzTV HotNewzTV attacker back erin fight girls girlsfightbackorg hnexpert home invasion outside public safety weed nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Green Yourself with Sara Snow Wed, 02 Sep 2009 19:50:37 -0800

Author: HotNewzTV
Added: Wed, 02 Sep 2009 19:50:37 -0800
Duration: 0

You don't have to go broke to go green! You can start saving the planet right from your dorm room or apartment. We speak with expert and author of "Fresh Living" Sara Snow. Distributed by Tubemogul.

]]> freshgreenlipslivingorganicplanetsarasnowsoft http://revver.com/video/1889922/green-yourself-with-sara-snow/ http://revver.com/watch/1889922 Green Yourself with Sara Snow You don't have to go broke to go green! You can start saving the planet right from your dorm room or apartment. We speak with expert and author of "Fresh Living" Sara Snow. Distributed by Tubemogul. You don't have to go broke to go green! You can start saving the planet right from your dorm room or apartment. We speak with expert and author of "Fresh Living" Sara Snow. Distributed by Tubemogul. HotNewzTV HotNewzTV fresh green lips living organic planet sara snow soft nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Weathergal: Lightning Wed, 03 Jun 2009 13:54:02 -0800

Author: HotNewzTV
Added: Wed, 03 Jun 2009 13:54:02 -0800
Duration: 0

50 to 100 lightning strikes occur every second!.. our Weathergal is here with tips on weathering the storm. Distributed by Tubemogul.

]]> carhnexpertlightningrainstormthundertreestubwater http://revver.com/video/1704004/weathergal-lightning/ http://revver.com/watch/1704004 Weathergal: Lightning 50 to 100 lightning strikes occur every second!.. our Weathergal is here with tips on weathering the storm. Distributed by Tubemogul. 50 to 100 lightning strikes occur every second!.. our Weathergal is here with tips on weathering the storm. Distributed by Tubemogul. HotNewzTV HotNewzTV car hnexpert lightning rain storm thunder trees tub water nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ University of Medicine and Health Sciences on St. Kitts Tue, 31 Mar 2009 23:52:42 -0800

Author: HotNewzTV
Added: Tue, 31 Mar 2009 23:52:42 -0800
Duration: 0

On track for a career as a doctor? A lot of those careers get derailed because of limits on American medical schools. Many qualified students are turned away because there are no slots left. But there is an opportunity if you're willing to expand your horizon literally. University of Medicine and Health Sciences on St. Kitts: "UMHS" offers top faculty and state of the art technology. Distributed by Tubemogul.

]]> careerdoctorhealthhncareerskittsmedicinesciencesstumhsuniversity http://revver.com/video/1567510/university-of-medicine-and-health-sciences-on-st-kitts/ http://revver.com/watch/1567510 University of Medicine and Health Sciences on St. Kitts On track for a career as a doctor? A lot of those careers get derailed because of limits on American medical schools. Many qualified students are turned away because there are no slots left. But there is an opportunity if you're willing to expand your horizon literally. University of Medicine and Health Sciences on St. Kitts: "UMHS" offers top faculty and state of the art technology. Distributed by Tubemogul. On track for a career as a doctor? A lot of those careers get derailed because of limits on American medical schools. Many qualified students are turned away because there are no slots left. But there is an opportunity if you're willing to expand your horizon literally. University of Medicine and Health Sciences on St. Kitts: "UMHS" offers top faculty and state of the art technology. Distributed by Tubemogul. HotNewzTV HotNewzTV career doctor health hncareers kitts medicine sciences st umhs university nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Go Green: Human Energy Tue, 31 Mar 2009 23:52:42 -0800

Author: HotNewzTV
Added: Tue, 31 Mar 2009 23:52:42 -0800
Duration: 50

Believe it or not, one of nature's energy sources is you! In Hong Kong and places like the Green Micro Gym in Oregon, exercise machines are used to harness the energy you produce while working out. Distributed by Tubemogul.

]]> bikesbyelectricityenergygreengymhngreenmicrogympoweredstationaryyou http://revver.com/video/1567511/go-green-human-energy/ http://revver.com/watch/1567511 Go Green: Human Energy Believe it or not, one of nature's energy sources is you! In Hong Kong and places like the Green Micro Gym in Oregon, exercise machines are used to harness the energy you produce while working out. Distributed by Tubemogul. Believe it or not, one of nature's energy sources is you! In Hong Kong and places like the Green Micro Gym in Oregon, exercise machines are used to harness the energy you produce while working out. Distributed by Tubemogul. HotNewzTV HotNewzTV bikes by electricity energy green gym hngreen microgym powered stationary you nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Need To Know: Apartment Inspection Tue, 31 Mar 2009 21:52:35 -0800

Author: HotNewzTV
Added: Tue, 31 Mar 2009 21:52:35 -0800
Duration: 0

When moving into a new apartment, make sure you inspect the place first for any damages... you don't want to lose your security deposit for problems that were there before you moved in. Distributed by Tubemogul.

]]> apartmentdamagesdeposithnn2khomeinspectionlandlordrentsecurity http://revver.com/video/1567079/need-to-know-apartment-inspection/ http://revver.com/watch/1567079 Need To Know: Apartment Inspection When moving into a new apartment, make sure you inspect the place first for any damages... you don't want to lose your security deposit for problems that were there before you moved in. Distributed by Tubemogul. When moving into a new apartment, make sure you inspect the place first for any damages... you don't want to lose your security deposit for problems that were there before you moved in. Distributed by Tubemogul. HotNewzTV HotNewzTV apartment damages deposit hnn2k home inspection landlord rent security nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Need To Know: Melanoma Sat, 28 Mar 2009 14:32:49 -0800

Author: HotNewzTV
Added: Sat, 28 Mar 2009 14:32:49 -0800
Duration: 30

How many times do we have to tell you? Too much sun can damage your skin.

]]> bedcancerhnn2kmelanomasalonskinsunsunburntanning http://revver.com/video/1541266/need-to-know-melanoma/ http://revver.com/watch/1541266 Need To Know: Melanoma How many times do we have to tell you? Too much sun can damage your skin. How many times do we have to tell you? Too much sun can damage your skin. HotNewzTV HotNewzTV bed cancer hnn2k melanoma salon skin sun sunburn tanning nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Need To Know: Salary Sat, 28 Mar 2009 02:32:32 -0800

Author: HotNewzTV
Added: Sat, 28 Mar 2009 02:32:32 -0800
Duration: 38

Here's a tip for your next job interview: don't tell them how much you want to be paid! Naming too high a number can turn the employer off, naming too low could cost you thousands!

]]> hnn2kincomeinterviewjobsalaryyearly http://revver.com/video/1551711/need-to-know-salary/ http://revver.com/watch/1551711 Need To Know: Salary Here's a tip for your next job interview: don't tell them how much you want to be paid! Naming too high a number can turn the employer off, naming too low could cost you thousands! Here's a tip for your next job interview: don't tell them how much you want to be paid! Naming too high a number can turn the employer off, naming too low could cost you thousands! HotNewzTV HotNewzTV hnn2k income interview job salary yearly nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ SWASH: Behind the Scenes Fri, 27 Mar 2009 23:33:04 -0800

Author: HotNewzTV
Added: Fri, 27 Mar 2009 23:33:04 -0800
Duration: 222

Ever wonder what it takes to be a HotNewz reporter? We go behind the scenes with our SWASH contest winner Colin and show him the ropes.

]]> behindcitycolinhnentertainmenthnfashionhotnewzkentuckynewreporterscenesstyleswashtideuniversityyork http://revver.com/video/1543158/swash-behind-the-scenes/ http://revver.com/watch/1543158 SWASH: Behind the Scenes Ever wonder what it takes to be a HotNewz reporter? We go behind the scenes with our SWASH contest winner Colin and show him the ropes. Ever wonder what it takes to be a HotNewz reporter? We go behind the scenes with our SWASH contest winner Colin and show him the ropes. HotNewzTV HotNewzTV behind city colin hnentertainment hnfashion hotnewz kentucky new reporter scenes style swash tide university york nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Web Watch: VideoSurf.com Thu, 26 Mar 2009 21:50:10 -0800

Author: HotNewzTV
Added: Thu, 26 Mar 2009 21:50:10 -0800
Duration: 37

Videosurf.com is video search engine that actually "sees" inside videos to find what you're looking for. Distributed by Tubemogul.

]]> enginefootagehnwebwatchsearchvideovideosurfcomyoutube http://revver.com/video/1558082/web-watch-videosurfcom/ http://revver.com/watch/1558082 Web Watch: VideoSurf.com Videosurf.com is video search engine that actually "sees" inside videos to find what you're looking for. Distributed by Tubemogul. Videosurf.com is video search engine that actually "sees" inside videos to find what you're looking for. Distributed by Tubemogul. HotNewzTV HotNewzTV engine footage hnwebwatch search video videosurfcom youtube nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ SWASH: Style Report Wed, 25 Mar 2009 21:53:32 -0800

Author: HotNewzTV
Added: Wed, 25 Mar 2009 21:53:32 -0800
Duration: 74

SWASH style reporter Colin has some tips on how to look good while doing something feel-good for the environment. Distributed by Tubemogul.

]]> colinecofriendlyhnentertainmenthnfashionhotnewzjohnkentuckyloomstateorganicpatrickpnaturlreporterstyleswashtideuniversity http://revver.com/video/1555968/swash-style-report/ http://revver.com/watch/1555968 SWASH: Style Report SWASH style reporter Colin has some tips on how to look good while doing something feel-good for the environment. Distributed by Tubemogul. SWASH style reporter Colin has some tips on how to look good while doing something feel-good for the environment. Distributed by Tubemogul. HotNewzTV HotNewzTV colin ecofriendly hnentertainment hnfashion hotnewz john kentucky loomstate organic patrick pnaturl reporter style swash tide university nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Inc.com: Is an MBA Worth it? Tue, 24 Mar 2009 22:53:54 -0800

Author: HotNewzTV
Added: Tue, 24 Mar 2009 22:53:54 -0800
Duration: 42

We know the economy is tanking, but resist the urge to hide out in b-school! Rod from Inc.com tells us why an MBA isn't necessary.

]]> businessexperiencehnexpertinccommbarealrodschoolsmartstanfordstreetuniversityworld http://revver.com/video/1554097/inccom-is-an-mba-worth-it/ http://revver.com/watch/1554097 Inc.com: Is an MBA Worth it? We know the economy is tanking, but resist the urge to hide out in b-school! Rod from Inc.com tells us why an MBA isn't necessary. We know the economy is tanking, but resist the urge to hide out in b-school! Rod from Inc.com tells us why an MBA isn't necessary. HotNewzTV HotNewzTV business experience hnexpert inccom mba real rod school smart stanford street university world nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ People Magazine: March 16, 2009 Fri, 20 Mar 2009 15:36:37 -0800

Author: HotNewzTV
Added: Fri, 20 Mar 2009 15:36:37 -0800
Duration: 100

Check out this week's hottest gossip from People Magazine including insider information on Rihanna and Chris Brown, dissed and dismissed Bachelor star Melissa Rycroft, wedding planner Vince Vaughn, CIA agent Gloria Estefan and Tahila Brookins.

]]> americasbachelorbrookinsbrowncelebritieschrisciaestefangloriagossiphnpeoplemagazinemelissamodelpeoplerihannarycrofttahilathetopvaughnvince http://revver.com/video/1538909/people-magazine-march-16-2009/ http://revver.com/watch/1538909 People Magazine: March 16, 2009 Check out this week's hottest gossip from People Magazine including insider information on Rihanna and Chris Brown, dissed and dismissed Bachelor star Melissa Rycroft, wedding planner Vince Vaughn, CIA agent Gloria Estefan and Tahila Brookins. Check out this week's hottest gossip from People Magazine including insider information on Rihanna and Chris Brown, dissed and dismissed Bachelor star Melissa Rycroft, wedding planner Vince Vaughn, CIA agent Gloria Estefan and Tahila Brookins. HotNewzTV HotNewzTV americas bachelor brookins brown celebrities chris cia estefan gloria gossip hnpeople magazine melissa model people rihanna rycroft tahila the top vaughn vince nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Weathergal: Cold Weather Tips Sun, 15 Mar 2009 17:49:55 -0800

Author: HotNewzTV
Added: Sun, 15 Mar 2009 17:49:55 -0800
Duration: 44

It's still cold outside! Luckily our Weathergal Yvonne has tips for keeping warm.

]]> coldcottonderelictehnexpertlayersnewspaperpapersocksweatherwinterwool http://revver.com/video/1533862/weathergal-cold-weather-tips/ http://revver.com/watch/1533862 Weathergal: Cold Weather Tips It's still cold outside! Luckily our Weathergal Yvonne has tips for keeping warm. It's still cold outside! Luckily our Weathergal Yvonne has tips for keeping warm. HotNewzTV HotNewzTV cold cotton derelicte hnexpert layers newspaper paper socks weather winter wool nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Maxim: Girlfriend's BFF Tue, 10 Mar 2009 19:49:41 -0800

Author: HotNewzTV
Added: Tue, 10 Mar 2009 19:49:41 -0800
Duration: 28

Jordan from Maxim Magazine has a tip for guys on how to deal with your girl's time-stealing best friend.

]]> bestfriendhnexpertlovemagazinemaximneedyrelationship http://revver.com/video/1528165/maxim-girlfriends-bff/ http://revver.com/watch/1528165 Maxim: Girlfriend's BFF Jordan from Maxim Magazine has a tip for guys on how to deal with your girl's time-stealing best friend. Jordan from Maxim Magazine has a tip for guys on how to deal with your girl's time-stealing best friend. HotNewzTV HotNewzTV best friend hnexpert love magazine maxim needy relationship nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Need To Know: Greener iPods Tue, 10 Mar 2009 14:31:58 -0800

Author: HotNewzTV
Added: Tue, 10 Mar 2009 14:31:58 -0800
Duration: 56

A few tips to keep your iPod in working condition (and a little greener!).

]]> 45ipodcasesapplebatterycaseecofriendlyhnn2kipodirepairmp3playerprotectiverepair http://revver.com/video/1526080/need-to-know-greener-ipods/ http://revver.com/watch/1526080 Need To Know: Greener iPods A few tips to keep your iPod in working condition (and a little greener!). A few tips to keep your iPod in working condition (and a little greener!). HotNewzTV HotNewzTV 45ipodcases apple battery case ecofriendly hnn2k ipod irepair mp3 player protective repair nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Inc.com: Catch a Piece of Maine Wed, 04 Feb 2009 17:16:40 -0800

Author: HotNewzTV
Added: Wed, 04 Feb 2009 17:16:40 -0800
Duration: 42

Brothers John and Brendan Ready create a seafood business worth millions... then go on to create another. Rent a lobster trap and keep the catch for yourself.

]]> brendancatchhnmoneyjohnkurtzlobstermainepiecereadyrodseafood http://revver.com/video/1469974/inccom-catch-a-piece-of-maine/ http://revver.com/watch/1469974 Inc.com: Catch a Piece of Maine Brothers John and Brendan Ready create a seafood business worth millions... then go on to create another. Rent a lobster trap and keep the catch for yourself. Brothers John and Brendan Ready create a seafood business worth millions... then go on to create another. Rent a lobster trap and keep the catch for yourself. HotNewzTV HotNewzTV brendan catch hnmoney john kurtz lobster maine piece ready rod seafood nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Sleep Doctor: All-Nighter Wed, 04 Feb 2009 17:16:40 -0800

Author: HotNewzTV
Added: Wed, 04 Feb 2009 17:16:40 -0800
Duration: 47

Dr. Michael Breus tells us if its better to pull an all-nighter or wake up early and cram for the exam.

]]> all-nighterbreuscramdrexamhnexpertlongmemorymichaelshortsleepstudyterm http://revver.com/video/1467114/sleep-doctor-all-nighter/ http://revver.com/watch/1467114 Sleep Doctor: All-Nighter Dr. Michael Breus tells us if its better to pull an all-nighter or wake up early and cram for the exam. Dr. Michael Breus tells us if its better to pull an all-nighter or wake up early and cram for the exam. HotNewzTV HotNewzTV all-nighter breus cram dr exam hnexpert long memory michael short sleep study term nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Need To Know: Aussie Happiness Tue, 27 Jan 2009 20:33:23 -0800

Author: HotNewzTV
Added: Tue, 27 Jan 2009 20:33:23 -0800
Duration: 34

Australian men say that spending time on the internet makes them happier than having sex.

]]> australiafamilyhnn2kinternetsex http://revver.com/video/1465004/need-to-know-aussie-happiness/ http://revver.com/watch/1465004 Need To Know: Aussie Happiness Australian men say that spending time on the internet makes them happier than having sex. Australian men say that spending time on the internet makes them happier than having sex. HotNewzTV HotNewzTV australia family hnn2k internet sex nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Alt Beats: Blood Red Shoes Mon, 26 Jan 2009 19:37:45 -0800

Author: HotNewzTV
Added: Mon, 26 Jan 2009 19:37:45 -0800
Duration: 43

Indy Rock photographer and blogger Abbey Braden gives us the scoop on punk band Blood Red Shoes.

]]> abbeybloodbradenhnmusiclauramarypunkredshoes http://revver.com/video/1457274/alt-beats-blood-red-shoes/ http://revver.com/watch/1457274 Alt Beats: Blood Red Shoes Indy Rock photographer and blogger Abbey Braden gives us the scoop on punk band Blood Red Shoes. Indy Rock photographer and blogger Abbey Braden gives us the scoop on punk band Blood Red Shoes. HotNewzTV HotNewzTV abbey blood braden hnmusic laura mary punk red shoes nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Funny or Die: Viral Advice Sat, 24 Jan 2009 20:33:21 -0800

Author: HotNewzTV
Added: Sat, 24 Jan 2009 20:33:21 -0800
Duration: 85

Dreaming of internet stardom? The experts at Funnyordie.com give tips on how to become an internet sensation.

]]> currentdieeventfastfunnyfunnyordiecomhncomedyloveparodyshortvideoviral http://revver.com/video/1455445/funny-or-die-viral-advice/ http://revver.com/watch/1455445 Funny or Die: Viral Advice Dreaming of internet stardom? The experts at Funnyordie.com give tips on how to become an internet sensation. Dreaming of internet stardom? The experts at Funnyordie.com give tips on how to become an internet sensation. HotNewzTV HotNewzTV current die event fast funny funnyordiecom hncomedy love parody short video viral nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Need To Know: Decision Foods Thu, 22 Jan 2009 23:52:35 -0800

Author: HotNewzTV
Added: Thu, 22 Jan 2009 23:52:35 -0800
Duration: 35

Eating foods like cheese and chocolate can actually help you make better decisions.

]]> bananascambridgecheesechocolatedecisionmeatmilkseinfeldtryptophanuniversity http://revver.com/video/1453218/need-to-know-decision-foods/ http://revver.com/watch/1453218 Need To Know: Decision Foods Eating foods like cheese and chocolate can actually help you make better decisions. Eating foods like cheese and chocolate can actually help you make better decisions. HotNewzTV HotNewzTV bananas cambridge cheese chocolate decision meat milk seinfeld tryptophan university nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Campus Camera: First Presidential Order Wed, 21 Jan 2009 18:32:04 -0800

Author: HotNewzTV
Added: Wed, 21 Jan 2009 18:32:04 -0800
Duration: 56

Barak Obama officially takes office today and no doubt he's going to have a lot on his plate. If you were elected President, what's the first thing you'd do?

]]> barackhncollegeobamaopinionspresidentstudent http://revver.com/video/1451016/campus-camera-first-presidential-order/ http://revver.com/watch/1451016 Campus Camera: First Presidential Order Barak Obama officially takes office today and no doubt he's going to have a lot on his plate. If you were elected President, what's the first thing you'd do? Barak Obama officially takes office today and no doubt he's going to have a lot on his plate. If you were elected President, what's the first thing you'd do? HotNewzTV HotNewzTV barack hncollege obama opinions president student nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ People Magazine: January 19, 2009 Tue, 20 Jan 2009 03:52:41 -0800

Author: HotNewzTV
Added: Tue, 20 Jan 2009 03:52:41 -0800
Duration: 67

David Caplan from People Magazine has the celebrity gossip this week, including the scoop on Partick Swayze, Dexter star Michael C. Hall, supermodel Gisele Bundchen and Patriot's Quarterback Tom Brady, and 'lil romancers Mika and Anna-Bell.

]]> anna-bellbradybundchenccaplancarpenterdavidgiselehallhnentertainmentjennifermagazinemichaelmikapatrickpeopleswayzetom http://revver.com/video/1450007/people-magazine-january-19-2009/ http://revver.com/watch/1450007 People Magazine: January 19, 2009 David Caplan from People Magazine has the celebrity gossip this week, including the scoop on Partick Swayze, Dexter star Michael C. Hall, supermodel Gisele Bundchen and Patriot's Quarterback Tom Brady, and 'lil romancers Mika and Anna-Bell. David Caplan from People Magazine has the celebrity gossip this week, including the scoop on Partick Swayze, Dexter star Michael C. Hall, supermodel Gisele Bundchen and Patriot's Quarterback Tom Brady, and 'lil romancers Mika and Anna-Bell. HotNewzTV HotNewzTV anna-bell brady bundchen c caplan carpenter david gisele hall hnentertainment jennifer magazine michael mika patrick people swayze tom nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Cosmo: Forgive a Cheater 2 Sat, 17 Jan 2009 01:52:42 -0800

Author: HotNewzTV
Added: Sat, 17 Jan 2009 01:52:42 -0800
Duration: 27

What do you do if your guy strays? Should you forgive him or give him the boot? Lesley from Cosmopolitan Magazine with reasons to forgive, or not to forgive.

]]> apologizecheatercosmocosmopolitanforgivenesshnrelationshiphooklesleyrelationshiprotchfordsexup http://revver.com/video/1441818/cosmo-forgive-a-cheater-2/ http://revver.com/watch/1441818 Cosmo: Forgive a Cheater 2 What do you do if your guy strays? Should you forgive him or give him the boot? Lesley from Cosmopolitan Magazine with reasons to forgive, or not to forgive. What do you do if your guy strays? Should you forgive him or give him the boot? Lesley from Cosmopolitan Magazine with reasons to forgive, or not to forgive. HotNewzTV HotNewzTV apologize cheater cosmo cosmopolitan forgiveness hnrelationship hook lesley relationship rotchford sex up nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Cheap Dates Thu, 15 Jan 2009 01:52:39 -0800

Author: HotNewzTV
Added: Thu, 15 Jan 2009 01:52:39 -0800
Duration: 69

The experts at PeopleJam.com want to show you why being a "cheap date" isn't a bad thing. Get your love life on track "recession style" with these five dates for under five bucks.

]]> bakecheapdatehnrelationshipkaraokepeoplejamcomrecessionsleddingtvwalk http://revver.com/video/1439557/cheap-dates/ http://revver.com/watch/1439557 Cheap Dates The experts at PeopleJam.com want to show you why being a "cheap date" isn't a bad thing. Get your love life on track "recession style" with these five dates for under five bucks. The experts at PeopleJam.com want to show you why being a "cheap date" isn't a bad thing. Get your love life on track "recession style" with these five dates for under five bucks. HotNewzTV HotNewzTV bake cheap date hnrelationship karaoke peoplejamcom recession sledding tv walk nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Funny or Die: Behind the Scenes Tue, 13 Jan 2009 17:52:35 -0800

Author: HotNewzTV
Added: Tue, 13 Jan 2009 17:52:35 -0800
Duration: 125

Funny or Die has been around for less than two years. But already, it's one of the hottest places for comedy on the internet. So what's it like to work there? We interview the guys behind the scenes at FunnyOrDie.com.

]]> adamamyapatowbryanchriscollegedieferrellfunnyfunnyordiecomhenchyhncomedyhumorjuddmckayrhodessafiwill http://revver.com/video/1437248/funny-or-die-behind-the-scenes/ http://revver.com/watch/1437248 Funny or Die: Behind the Scenes Funny or Die has been around for less than two years. But already, it's one of the hottest places for comedy on the internet. So what's it like to work there? We interview the guys behind the scenes at FunnyOrDie.com. Funny or Die has been around for less than two years. But already, it's one of the hottest places for comedy on the internet. So what's it like to work there? We interview the guys behind the scenes at FunnyOrDie.com. HotNewzTV HotNewzTV adam amy apatow bryan chris college die ferrell funny funnyordiecom henchy hncomedy humor judd mckay rhodes safi will nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Need To Know: College Health Surveys Mon, 12 Jan 2009 18:31:49 -0800

Author: HotNewzTV
Added: Mon, 12 Jan 2009 18:31:49 -0800
Duration: 35

The American College Health Association surveys students around the country... here's what they found out about how you're taking care of yourselves.

]]> americanassociationcollegecondomdentistexercisegynecologisthealthhnn2knewssexsurvey http://revver.com/video/1434542/need-to-know-college-health-surveys/ http://revver.com/watch/1434542 Need To Know: College Health Surveys The American College Health Association surveys students around the country... here's what they found out about how you're taking care of yourselves. The American College Health Association surveys students around the country... here's what they found out about how you're taking care of yourselves. HotNewzTV HotNewzTV american association college condom dentist exercise gynecologist health hnn2k news sex survey nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Scholarship: Create a Greeting Card Sun, 11 Jan 2009 18:31:46 -0800

Author: HotNewzTV
Added: Sun, 11 Jan 2009 18:31:46 -0800
Duration: 38

The Gallery Collection is a company that makes greeting cards... and you could win some serious cash by designing one for them.

]]> cardcollectiondesigngallerygreetinghnscholarshipphotographscholarship http://revver.com/video/1432822/scholarship-create-a-greeting-card/ http://revver.com/watch/1432822 Scholarship: Create a Greeting Card The Gallery Collection is a company that makes greeting cards... and you could win some serious cash by designing one for them. The Gallery Collection is a company that makes greeting cards... and you could win some serious cash by designing one for them. HotNewzTV HotNewzTV card collection design gallery greeting hnscholarship photograph scholarship nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Youngest Professor Sat, 10 Jan 2009 23:31:45 -0800

Author: HotNewzTV
Added: Sat, 10 Jan 2009 23:31:45 -0800
Duration: 100

As a child prodigy, Alia Sabur's been breaking records all her life, and at 18 she became the youngest college professor ever.

]]> aliabookguinnessnanoprofessorrecordssaburtechnologyworldyoungest http://revver.com/video/1431225/youngest-professor/ http://revver.com/watch/1431225 Youngest Professor As a child prodigy, Alia Sabur's been breaking records all her life, and at 18 she became the youngest college professor ever. As a child prodigy, Alia Sabur's been breaking records all her life, and at 18 she became the youngest college professor ever. HotNewzTV HotNewzTV alia book guinness nano professor records sabur technology world youngest nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Girls Fight Back: Verbal Defense Thu, 08 Jan 2009 18:49:40 -0800

Author: HotNewzTV
Added: Thu, 08 Jan 2009 18:49:40 -0800
Duration: 28

Erin Weed from Girls Fight Back talks about verbal self-defense, because the best fight is the fight that's never fought.

]]> backerinfightgirlsgirlsfightbackorgself-defenseverbalweed http://revver.com/video/1427452/girls-fight-back-verbal-defense/ http://revver.com/watch/1427452 Girls Fight Back: Verbal Defense Erin Weed from Girls Fight Back talks about verbal self-defense, because the best fight is the fight that's never fought. Erin Weed from Girls Fight Back talks about verbal self-defense, because the best fight is the fight that's never fought. HotNewzTV HotNewzTV back erin fight girls girlsfightbackorg self-defense verbal weed nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Need to Know: Chew This! Mon, 15 Dec 2008 14:52:45 -0800

Author: HotNewzTV
Added: Mon, 15 Dec 2008 14:52:45 -0800
Duration: 27

Chewing gum may make you look ditzy, but an experiment at Cornell University suggests it may actually make you smarter.

]]> chewingcornellexperimentgumhnn2ksmarterstudyuniversity http://revver.com/video/1381428/need-to-know-chew-this/ http://revver.com/watch/1381428 Need to Know: Chew This! Chewing gum may make you look ditzy, but an experiment at Cornell University suggests it may actually make you smarter. Chewing gum may make you look ditzy, but an experiment at Cornell University suggests it may actually make you smarter. HotNewzTV HotNewzTV chewing cornell experiment gum hnn2k smarter study university nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Are You Freakin' Kidding Me!?: Minty Shoes Mon, 15 Dec 2008 14:52:45 -0800

Author: HotNewzTV
Added: Mon, 15 Dec 2008 14:52:45 -0800
Duration: 49

Freshen your step with this Japanese invention that may give Doctor Scholls a run for his money.

]]> feetfreshhnkiddinginsolesjapanjapanesemintyshoes http://revver.com/video/1381429/are-you-freakin-kidding-me-minty-shoes/ http://revver.com/watch/1381429 Are You Freakin' Kidding Me!?: Minty Shoes Freshen your step with this Japanese invention that may give Doctor Scholls a run for his money. Freshen your step with this Japanese invention that may give Doctor Scholls a run for his money. HotNewzTV HotNewzTV feet fresh hnkidding insoles japan japanese minty shoes nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Leadership Spotlight: Matthew Good Mon, 15 Dec 2008 14:52:45 -0800

Author: HotNewzTV
Added: Mon, 15 Dec 2008 14:52:45 -0800
Duration: 53

The American Express Leadership Spotlight shines on Matthew Good and his work at Jobs for Illinois Graduates, a non-profit company that works with at-risk students and puts them on a career path.

]]> americanamexcareerexpressforgoodgraduateshnamexillinoisjobsleadershipmatthewnon-profitspotlightstudents http://revver.com/video/1381430/leadership-spotlight-matthew-good/ http://revver.com/watch/1381430 Leadership Spotlight: Matthew Good The American Express Leadership Spotlight shines on Matthew Good and his work at Jobs for Illinois Graduates, a non-profit company that works with at-risk students and puts them on a career path. The American Express Leadership Spotlight shines on Matthew Good and his work at Jobs for Illinois Graduates, a non-profit company that works with at-risk students and puts them on a career path. HotNewzTV HotNewzTV american amex career express for good graduates hnamex illinois jobs leadership matthew non-profit spotlight students nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Web Watch: Find a Grave Mon, 15 Dec 2008 14:52:45 -0800

Author: HotNewzTV
Added: Mon, 15 Dec 2008 14:52:45 -0800
Duration: 35

Find a Grave has info for over 17 million dead people, from A - that's Anna Nicole Smith - to Z - that's President Zachary Taylor.

]]> burieddeadfindgravegraveshnwebwatch http://revver.com/video/1381431/web-watch-find-a-grave/ http://revver.com/watch/1381431 Web Watch: Find a Grave Find a Grave has info for over 17 million dead people, from A - that's Anna Nicole Smith - to Z - that's President Zachary Taylor. Find a Grave has info for over 17 million dead people, from A - that's Anna Nicole Smith - to Z - that's President Zachary Taylor. HotNewzTV HotNewzTV buried dead find grave graves hnwebwatch nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Campus Camera: What Do You Want This Holiday Season? Mon, 15 Dec 2008 14:52:45 -0800

Author: HotNewzTV
Added: Mon, 15 Dec 2008 14:52:45 -0800
Duration: 66

Students from around the country tell us the ONE thing they really want this holiday season.

]]> giftshncollegeholidaynewsopinionstudent http://revver.com/video/1381432/campus-camera-what-do-you-want-this-holiday-season/ http://revver.com/watch/1381432 Campus Camera: What Do You Want This Holiday Season? Students from around the country tell us the ONE thing they really want this holiday season. Students from around the country tell us the ONE thing they really want this holiday season. HotNewzTV HotNewzTV gifts hncollege holiday news opinion student nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Now Playing: December 12, 2008 Fri, 12 Dec 2008 16:31:51 -0800

Author: HotNewzTV
Added: Fri, 12 Dec 2008 16:31:51 -0800
Duration: 99

Check out new movies this week including Doubt, The Reader, and the Klaatu, er, Keanu Reeves sci-fi re-imagining of The Day The Earth Stood Still... complete with Gort.

]]> adamsamydaydoubtearthhnmovieshoffmankeanumerylphillipreaderreevesseymourstillstoodstreepthe http://revver.com/video/1376009/now-playing-december-12-2008/ http://revver.com/watch/1376009 Now Playing: December 12, 2008 Check out new movies this week including Doubt, The Reader, and the Klaatu, er, Keanu Reeves sci-fi re-imagining of The Day The Earth Stood Still... complete with Gort. Check out new movies this week including Doubt, The Reader, and the Klaatu, er, Keanu Reeves sci-fi re-imagining of The Day The Earth Stood Still... complete with Gort. HotNewzTV HotNewzTV adams amy day doubt earth hnmovies hoffman keanu meryl phillip reader reeves seymour still stood streep the nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ AXE Hair SOS: Washing Fri, 12 Dec 2008 16:31:51 -0800

Author: HotNewzTV
Added: Fri, 12 Dec 2008 16:31:51 -0800
Duration: 68

Celebrity Hair Stylist Diana Schmidtke drives home how important it is to wash your hair!

]]> axede-gluedianahairhnpackagelookproductputtyschmidtkescrubshampoospiked-upwashing http://revver.com/video/1376010/axe-hair-sos-washing/ http://revver.com/watch/1376010 AXE Hair SOS: Washing Celebrity Hair Stylist Diana Schmidtke drives home how important it is to wash your hair! Celebrity Hair Stylist Diana Schmidtke drives home how important it is to wash your hair! HotNewzTV HotNewzTV axe de-glue diana hair hnpackage look product putty schmidtke scrub shampoo spiked-up washing nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Web Watch: Knitty Fri, 12 Dec 2008 16:31:51 -0800

Author: HotNewzTV
Added: Fri, 12 Dec 2008 16:31:51 -0800
Duration: 38

Knitting is knotty! Two hot sites for the price of one, including Knitty... an online magazine for the needle-inclined.

]]> hnwebwatchknittingknittypatternsstitchingyarn http://revver.com/video/1376011/web-watch-knitty/ http://revver.com/watch/1376011 Web Watch: Knitty Knitting is knotty! Two hot sites for the price of one, including Knitty... an online magazine for the needle-inclined. Knitting is knotty! Two hot sites for the price of one, including Knitty... an online magazine for the needle-inclined. HotNewzTV HotNewzTV hnwebwatch knitting knitty patterns stitching yarn nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Need to Know: Email Addresses Fri, 12 Dec 2008 16:31:51 -0800

Author: HotNewzTV
Added: Fri, 12 Dec 2008 16:31:51 -0800
Duration: 55

A new study shows that your email address may make a crucial difference when applying for a job.

]]> addresscareeremailemployeeemployerhnn2kinterviewjobsresume http://revver.com/video/1376012/need-to-know-email-addresses/ http://revver.com/watch/1376012 Need to Know: Email Addresses A new study shows that your email address may make a crucial difference when applying for a job. A new study shows that your email address may make a crucial difference when applying for a job. HotNewzTV HotNewzTV address career email employee employer hnn2k interview jobs resume nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ College News: December 11, 2008 Thu, 11 Dec 2008 23:52:35 -0800

Author: HotNewzTV
Added: Thu, 11 Dec 2008 23:52:35 -0800
Duration: 70

Headlines from college campuses across the country including a national study says that students aren't meeting professors' standards, schools that are struggling to preserve financial aid for students, and "Office" star John Krasinski returns to Brown.

]]> actingaidbrowncrisiseconomicfinancialhncollegehnnewsjohnkrasinskiofficeprofessorsstandardsstudentstheuniversity http://revver.com/video/1373540/college-news-december-11-2008/ http://revver.com/watch/1373540 College News: December 11, 2008 Headlines from college campuses across the country including a national study says that students aren't meeting professors' standards, schools that are struggling to preserve financial aid for students, and "Office" star John Krasinski returns to Brown. Headlines from college campuses across the country including a national study says that students aren't meeting professors' standards, schools that are struggling to preserve financial aid for students, and "Office" star John Krasinski returns to Brown. HotNewzTV HotNewzTV acting aid brown crisis economic financial hncollege hnnews john krasinski office professors standards students the university nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Leadership Spotlight: David McKinney Thu, 11 Dec 2008 23:52:35 -0800

Author: HotNewzTV
Added: Thu, 11 Dec 2008 23:52:35 -0800
Duration: 64

The American Express Leadership Spotlight shines on David McKinney and his work at Public Allies, a non-profit organization whose goal is to get the next generation involved in non-profit work.

]]> alliesamericanamexbloombergdavidexpresshnamexmayormckinnymichaelnon-profitpublic http://revver.com/video/1373541/leadership-spotlight-david-mckinney/ http://revver.com/watch/1373541 Leadership Spotlight: David McKinney The American Express Leadership Spotlight shines on David McKinney and his work at Public Allies, a non-profit organization whose goal is to get the next generation involved in non-profit work. The American Express Leadership Spotlight shines on David McKinney and his work at Public Allies, a non-profit organization whose goal is to get the next generation involved in non-profit work. HotNewzTV HotNewzTV allies american amex bloomberg david express hnamex mayor mckinny michael non-profit public nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ AXE Hair SOS: Style Thu, 11 Dec 2008 23:52:35 -0800

Author: HotNewzTV
Added: Thu, 11 Dec 2008 23:52:35 -0800
Duration: 96

Celebrity hair stylist Diana Schmidtke gives guys tips on how to style their hair.

]]> axeclooneydamondianageorgegyllenhaalhairhnexperthnfashionjakelookmattmessypasteschmidtkestyle http://revver.com/video/1373542/axe-hair-sos-style/ http://revver.com/watch/1373542 AXE Hair SOS: Style Celebrity hair stylist Diana Schmidtke gives guys tips on how to style their hair. Celebrity hair stylist Diana Schmidtke gives guys tips on how to style their hair. HotNewzTV HotNewzTV axe clooney damon diana george gyllenhaal hair hnexpert hnfashion jake look matt messy paste schmidtke style nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Scholarship: Gaia.com Thu, 11 Dec 2008 23:52:35 -0800

Author: HotNewzTV
Added: Thu, 11 Dec 2008 23:52:35 -0800
Duration: 31

Gaia.com is offering $1,000 to individuals who can write the most inspiring answers to three questions: What is your purpose? What do you love? And What is your ideal job description?

]]> gaiagaiacomhnscholarshipinspirationaljoblovepurposescholarship http://revver.com/video/1373543/scholarship-gaiacom/ http://revver.com/watch/1373543 Scholarship: Gaia.com Gaia.com is offering $1,000 to individuals who can write the most inspiring answers to three questions: What is your purpose? What do you love? And What is your ideal job description? Gaia.com is offering $1,000 to individuals who can write the most inspiring answers to three questions: What is your purpose? What do you love? And What is your ideal job description? HotNewzTV HotNewzTV gaia gaiacom hnscholarship inspirational job love purpose scholarship nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Justify Your Existence: Support Our Troops Wed, 10 Dec 2008 17:52:40 -0800

Author: HotNewzTV
Added: Wed, 10 Dec 2008 17:52:40 -0800
Duration: 29

Our troops appreciate you saying how much you support them, but consider putting together a care package to brighten a GI's day.

]]> airarmedarmycareeastforceforcesgihnjustifyiraqmarinesmiddlemilitarynavyourpackagesupporttroops http://revver.com/video/1370685/justify-your-existence-support-our-troops/ http://revver.com/watch/1370685 Justify Your Existence: Support Our Troops Our troops appreciate you saying how much you support them, but consider putting together a care package to brighten a GI's day. Our troops appreciate you saying how much you support them, but consider putting together a care package to brighten a GI's day. HotNewzTV HotNewzTV air armed army care east force forces gi hnjustify iraq marines middle military navy our package support troops nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Need to Know: Intern Advice Wed, 10 Dec 2008 17:52:40 -0800

Author: HotNewzTV
Added: Wed, 10 Dec 2008 17:52:40 -0800
Duration: 37

An internship can be more than just a line on your resume. Here's how to turn it into a full time job!

]]> careerexperiencecomhnn2kinternshipjobresume http://revver.com/video/1370686/need-to-know-intern-advice/ http://revver.com/watch/1370686 Need to Know: Intern Advice An internship can be more than just a line on your resume. Here's how to turn it into a full time job! An internship can be more than just a line on your resume. Here's how to turn it into a full time job! HotNewzTV HotNewzTV career experiencecom hnn2k internship job resume nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Website: Phonevite.com Wed, 10 Dec 2008 17:52:40 -0800

Author: HotNewzTV
Added: Wed, 10 Dec 2008 17:52:40 -0800
Duration: 45

Evite is getting kinda dated. The next time you're planning a bash, impress your friends with Phonevite.

]]> hnwebwatchinvitephonephonevitephonevitecomévite http://revver.com/video/1370687/website-phonevitecom/ http://revver.com/watch/1370687 Website: Phonevite.com Evite is getting kinda dated. The next time you're planning a bash, impress your friends with Phonevite. Evite is getting kinda dated. The next time you're planning a bash, impress your friends with Phonevite. HotNewzTV HotNewzTV hnwebwatch invite phone phonevite phonevitecom évite nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ AXE Hair SOS: Poofy Hair Wed, 10 Dec 2008 17:52:40 -0800

Author: HotNewzTV
Added: Wed, 10 Dec 2008 17:52:40 -0800
Duration: 64

Celebrity hair stylist Diana Schmidtke is giving tips on how guys can combat poofy hair.

]]> axede-poofdianadryhairhnexperthnfashionpoofyproductschmidtkeshampootowel http://revver.com/video/1370688/axe-hair-sos-poofy-hair/ http://revver.com/watch/1370688 AXE Hair SOS: Poofy Hair Celebrity hair stylist Diana Schmidtke is giving tips on how guys can combat poofy hair. Celebrity hair stylist Diana Schmidtke is giving tips on how guys can combat poofy hair. HotNewzTV HotNewzTV axe de-poof diana dry hair hnexpert hnfashion poofy product schmidtke shampoo towel nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Leadership Spotlight: Sherazade Langlade Tue, 09 Dec 2008 12:33:25 -0800

Author: HotNewzTV
Added: Tue, 09 Dec 2008 12:33:25 -0800
Duration: 59

The American Express Leadership Spotlight shines on Sherazade Langlade and her work with Upwardly Global NYC, a non-profit company that helps immigrants find jobs.

]]> americanamexexpressglobalhnameximmigrantslangladeleadershipnycsherazadespotlightupwardly http://revver.com/video/1368473/leadership-spotlight-sherazade-langlade/ http://revver.com/watch/1368473 Leadership Spotlight: Sherazade Langlade The American Express Leadership Spotlight shines on Sherazade Langlade and her work with Upwardly Global NYC, a non-profit company that helps immigrants find jobs. The American Express Leadership Spotlight shines on Sherazade Langlade and her work with Upwardly Global NYC, a non-profit company that helps immigrants find jobs. HotNewzTV HotNewzTV american amex express global hnamex immigrants langlade leadership nyc sherazade spotlight upwardly nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ College News: December 9, 2008 Tue, 09 Dec 2008 11:31:46 -0800

Author: HotNewzTV
Added: Tue, 09 Dec 2008 11:31:46 -0800
Duration: 66

Top stories from college campuses including animal rights extremists at UCLA cause a violent protest, one U-Conn student takes time off to travel the world on a motorcycle, and students from Oregon celebrate World Aids Day with a Condom Fashion Show.

]]> aidsargentinacarcondomconnecticutdayfashionfireforhncollegejeffliberationmotorcycleoregonprimatesroyshowstudentsu-connuclauniversityworkersworld http://revver.com/video/1368271/college-news-december-9-2008/ http://revver.com/watch/1368271 College News: December 9, 2008 Top stories from college campuses including animal rights extremists at UCLA cause a violent protest, one U-Conn student takes time off to travel the world on a motorcycle, and students from Oregon celebrate World Aids Day with a Condom Fashion Show. Top stories from college campuses including animal rights extremists at UCLA cause a violent protest, one U-Conn student takes time off to travel the world on a motorcycle, and students from Oregon celebrate World Aids Day with a Condom Fashion Show. HotNewzTV HotNewzTV aids argentina car condom connecticut day fashion fire for hncollege jeff liberation motorcycle oregon primates roy show students u-conn ucla university workers world nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Hot Tunes: December 9, 2008 Tue, 09 Dec 2008 11:31:46 -0800

Author: HotNewzTV
Added: Tue, 09 Dec 2008 11:31:46 -0800
Duration: 67

Check out new music today from Common, Musiq Soulchild and Brandy.

]]> bligebrandycommoncontrolhnmusichumanifuleavejkanyemarymindmusiqmyneptunesonpharellradiosoulchildtheuniversalwest http://revver.com/video/1368272/hot-tunes-december-9-2008/ http://revver.com/watch/1368272 Hot Tunes: December 9, 2008 Check out new music today from Common, Musiq Soulchild and Brandy. Check out new music today from Common, Musiq Soulchild and Brandy. HotNewzTV HotNewzTV blige brandy common control hnmusic human ifuleave j kanye mary mind musiq my neptunes on pharell radio soulchild the universal west nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Leadership Spotlight: Sherazade Langlade Tue, 09 Dec 2008 11:31:46 -0800

Author: HotNewzTV
Added: Tue, 09 Dec 2008 11:31:46 -0800
Duration: 59

The American Express Leadership Spotlight shines on Sherazade Langlade and her work with Upwardly Global NYC, a non-profit company that helps immigrants find jobs.

]]> americanamexexpressglobalhnameximmigrantslangladeleadershipnycsherazadespotlightupwardly http://revver.com/video/1368273/leadership-spotlight-sherazade-langlade/ http://revver.com/watch/1368273 Leadership Spotlight: Sherazade Langlade The American Express Leadership Spotlight shines on Sherazade Langlade and her work with Upwardly Global NYC, a non-profit company that helps immigrants find jobs. The American Express Leadership Spotlight shines on Sherazade Langlade and her work with Upwardly Global NYC, a non-profit company that helps immigrants find jobs. HotNewzTV HotNewzTV american amex express global hnamex immigrants langlade leadership nyc sherazade spotlight upwardly nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ AXE Hair SOS: How Important is Hair? Tue, 09 Dec 2008 11:31:46 -0800

Author: HotNewzTV
Added: Tue, 09 Dec 2008 11:31:46 -0800
Duration: 83

Celebrity hair stylist Diana Schmidtke gives guys tips on maintaining great hair with Axe's new line of products for men.

]]> axeclooneydamondianageorgegyllenhaalhairhnexperthnfashionjakemattschmidtkesurvey http://revver.com/video/1368274/axe-hair-sos-how-important-is-hair/ http://revver.com/watch/1368274 AXE Hair SOS: How Important is Hair? Celebrity hair stylist Diana Schmidtke gives guys tips on maintaining great hair with Axe's new line of products for men. Celebrity hair stylist Diana Schmidtke gives guys tips on maintaining great hair with Axe's new line of products for men. HotNewzTV HotNewzTV axe clooney damon diana george gyllenhaal hair hnexpert hnfashion jake matt schmidtke survey nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Need to Know: Depression Mon, 08 Dec 2008 15:31:46 -0800

Author: HotNewzTV
Added: Mon, 08 Dec 2008 15:31:46 -0800
Duration: 31

More than a third of college students say that in the past year, they've been so depressed that it was difficult to function.

]]> 1-800-422-hopecollegedepressionhnn2kstudentssuicide http://revver.com/video/1365961/need-to-know-depression/ http://revver.com/watch/1365961 Need to Know: Depression More than a third of college students say that in the past year, they've been so depressed that it was difficult to function. More than a third of college students say that in the past year, they've been so depressed that it was difficult to function. HotNewzTV HotNewzTV 1-800-422-hope college depression hnn2k students suicide nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Web Watch: Trailers From Hell Mon, 08 Dec 2008 15:31:46 -0800

Author: HotNewzTV
Added: Mon, 08 Dec 2008 15:31:46 -0800
Duration: 29

Trailers From Hell lets you watch previews for old-timey b-movies.

]]> animalb-moviescommentarydeadfromhellhnwebwatchhostelhousejohnlandisshauntrailerswebsite http://revver.com/video/1365962/web-watch-trailers-from-hell/ http://revver.com/watch/1365962 Web Watch: Trailers From Hell Trailers From Hell lets you watch previews for old-timey b-movies. Trailers From Hell lets you watch previews for old-timey b-movies. HotNewzTV HotNewzTV animal b-movies commentary dead from hell hnwebwatch hostel house john landis shaun trailers website nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Fashion Fix: Sunless Tan Mon, 08 Dec 2008 15:31:46 -0800

Author: HotNewzTV
Added: Mon, 08 Dec 2008 15:31:46 -0800
Duration: 49

Guys, if you want sunless tan, you gotta make sure you do it right. Here's a fashion fix from Details Magazine.

]]> bamboodetailsexfoliatehnfashionmagazinemenscrubsunlesstantanner http://revver.com/video/1365963/fashion-fix-sunless-tan/ http://revver.com/watch/1365963 Fashion Fix: Sunless Tan Guys, if you want sunless tan, you gotta make sure you do it right. Here's a fashion fix from Details Magazine. Guys, if you want sunless tan, you gotta make sure you do it right. Here's a fashion fix from Details Magazine. HotNewzTV HotNewzTV bamboo details exfoliate hnfashion magazine men scrub sunless tan tanner nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Body Language: Lies of Transference Mon, 08 Dec 2008 06:52:40 -0800

Author: HotNewzTV
Added: Mon, 08 Dec 2008 06:52:40 -0800
Duration: 45

Learn how to be a good liar from interrogation expert Greg Hartley.

]]> greghartleyhnexpertliestransference http://revver.com/video/1365960/body-language-lies-of-transference/ http://revver.com/watch/1365960 Body Language: Lies of Transference Learn how to be a good liar from interrogation expert Greg Hartley. Learn how to be a good liar from interrogation expert Greg Hartley. HotNewzTV HotNewzTV greg hartley hnexpert lies transference nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Now Playing: December 5, 2008 Fri, 05 Dec 2008 11:52:38 -0800

Author: HotNewzTV
Added: Fri, 05 Dec 2008 11:52:38 -0800
Duration: 75

Check out what's new in theaters this weekend including Frost/Nixon, the story of BBC host David Frost's interview with former president Richard Nixon, and Punisher: War Zone.

]]> davidfrostfrost/nixonhnmoviesnixonpunisherrichardwarzone http://revver.com/video/1360570/now-playing-december-5-2008/ http://revver.com/watch/1360570 Now Playing: December 5, 2008 Check out what's new in theaters this weekend including Frost/Nixon, the story of BBC host David Frost's interview with former president Richard Nixon, and Punisher: War Zone. Check out what's new in theaters this weekend including Frost/Nixon, the story of BBC host David Frost's interview with former president Richard Nixon, and Punisher: War Zone. HotNewzTV HotNewzTV david frost frost/nixon hnmovies nixon punisher richard war zone nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Gadgets: Projector Fri, 05 Dec 2008 11:52:38 -0800

Author: HotNewzTV
Added: Fri, 05 Dec 2008 11:52:38 -0800
Duration: 47

George Washington University's Derek Tarnow tells us about a great dorm room gadget to project your vids on the cheap.

]]> derekgadgetsgeorgehnshoppinghntechmoviesmp3projectorslideshowstarnowuniversitywashington http://revver.com/video/1360571/gadgets-projector/ http://revver.com/watch/1360571 Gadgets: Projector George Washington University's Derek Tarnow tells us about a great dorm room gadget to project your vids on the cheap. George Washington University's Derek Tarnow tells us about a great dorm room gadget to project your vids on the cheap. HotNewzTV HotNewzTV derek gadgets george hnshopping hntech movies mp3 projector slideshows tarnow university washington nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Need to Know: Socks and Sleep Fri, 05 Dec 2008 11:52:38 -0800

Author: HotNewzTV
Added: Fri, 05 Dec 2008 11:52:38 -0800
Duration: 32

Dutch researchers did a study to see if what people wore to bed helped them fall asleep.

]]> bedfeethnn2ksleepsocksstudy http://revver.com/video/1360572/need-to-know-socks-and-sleep/ http://revver.com/watch/1360572 Need to Know: Socks and Sleep Dutch researchers did a study to see if what people wore to bed helped them fall asleep. Dutch researchers did a study to see if what people wore to bed helped them fall asleep. HotNewzTV HotNewzTV bed feet hnn2k sleep socks study nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Miss America: Kirsten Haglund Fri, 05 Dec 2008 11:52:38 -0800

Author: HotNewzTV
Added: Fri, 05 Dec 2008 11:52:38 -0800
Duration: 86

She's smart, funny, and oh yeah, she's also Miss America. Hotnewz recently caught up with Kirsten Haglund.

]]> americadisordereatinghaglundhnentertainmentinterviewkirstenmiss http://revver.com/video/1360573/miss-america-kirsten-haglund/ http://revver.com/watch/1360573 Miss America: Kirsten Haglund She's smart, funny, and oh yeah, she's also Miss America. Hotnewz recently caught up with Kirsten Haglund. She's smart, funny, and oh yeah, she's also Miss America. Hotnewz recently caught up with Kirsten Haglund. HotNewzTV HotNewzTV america disorder eating haglund hnentertainment interview kirsten miss nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Need to Know: Free 411 Thu, 04 Dec 2008 18:49:49 -0800

Author: HotNewzTV
Added: Thu, 04 Dec 2008 18:49:49 -0800
Duration: 42

You may not realize it, but the phone companies charge you for every 411 call you make. But there are free alternatives.

]]> 411assistancecelldirectoryfreegooglehnn2kphone http://revver.com/video/1358429/need-to-know-free-411/ http://revver.com/watch/1358429 Need to Know: Free 411 You may not realize it, but the phone companies charge you for every 411 call you make. But there are free alternatives. You may not realize it, but the phone companies charge you for every 411 call you make. But there are free alternatives. HotNewzTV HotNewzTV 411 assistance cell directory free google hnn2k phone nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Leadership Spotlight: Mark Wier Thu, 04 Dec 2008 18:49:49 -0800

Author: HotNewzTV
Added: Thu, 04 Dec 2008 18:49:49 -0800
Duration: 59

The American Express Leadership Spotlight shines on Mark Wier for his work with the International Rescue Committee, an organization committed to helping people rebuild their homes.

]]> americanamexcommitteeexpressharmhnamexhomeinternataionalircmarknon-profitrescuetowier http://revver.com/video/1358430/leadership-spotlight-mark-wier/ http://revver.com/watch/1358430 Leadership Spotlight: Mark Wier The American Express Leadership Spotlight shines on Mark Wier for his work with the International Rescue Committee, an organization committed to helping people rebuild their homes. The American Express Leadership Spotlight shines on Mark Wier for his work with the International Rescue Committee, an organization committed to helping people rebuild their homes. HotNewzTV HotNewzTV american amex committee express harm hnamex home internataional irc mark non-profit rescue to wier nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Scholarship: Elie Wiesel Ethics Thu, 04 Dec 2008 18:49:49 -0800

Author: HotNewzTV
Added: Thu, 04 Dec 2008 18:49:49 -0800
Duration: 38

The Elie Wiesel Foundation for Humanity is asking student to submit essays on ethics. In return you could win a $5,000 scholarship.

]]> elieethicsforfoundationhnscholarshiphumanityscholarshipwiesel http://revver.com/video/1358431/scholarship-elie-wiesel-ethics/ http://revver.com/watch/1358431 Scholarship: Elie Wiesel Ethics The Elie Wiesel Foundation for Humanity is asking student to submit essays on ethics. In return you could win a $5,000 scholarship. The Elie Wiesel Foundation for Humanity is asking student to submit essays on ethics. In return you could win a $5,000 scholarship. HotNewzTV HotNewzTV elie ethics for foundation hnscholarship humanity scholarship wiesel nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Lucky Magazine: Beautiful Eyes Thu, 04 Dec 2008 17:52:37 -0800

Author: HotNewzTV
Added: Thu, 04 Dec 2008 17:52:37 -0800
Duration: 66

Tips from Lucky Magazine on how to look fresh and beautiful!

]]> beautychristinadorfeyegivenchyhnfashionlightlinerluckymagazinemakemistermuellerpaulapuffysawyersleepslepttiredtriciaup http://revver.com/video/1358428/lucky-magazine-beautiful-eyes/ http://revver.com/watch/1358428 Lucky Magazine: Beautiful Eyes Tips from Lucky Magazine on how to look fresh and beautiful! Tips from Lucky Magazine on how to look fresh and beautiful! HotNewzTV HotNewzTV beauty christina dorf eye givenchy hnfashion light liner lucky magazine make mister mueller paula puffy sawyer sleep slept tired tricia up nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Need to Know: Exercise Wed, 03 Dec 2008 18:52:37 -0800

Author: HotNewzTV
Added: Wed, 03 Dec 2008 18:52:37 -0800
Duration: 22

A recent survey reveals that more than half of college women have exercised to lose weight in the past 30 days.

]]> collegedietexercisefemalehnn2klosssurveyweightwomen http://revver.com/video/1356231/need-to-know-exercise/ http://revver.com/watch/1356231 Need to Know: Exercise A recent survey reveals that more than half of college women have exercised to lose weight in the past 30 days. A recent survey reveals that more than half of college women have exercised to lose weight in the past 30 days. HotNewzTV HotNewzTV college diet exercise female hnn2k loss survey weight women nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Karaoke Murders Wed, 03 Dec 2008 18:52:37 -0800

Author: HotNewzTV
Added: Wed, 03 Dec 2008 18:52:37 -0800
Duration: 21

A man in Thailand shot and killed eight of his neighbors... because he couldn't stand their loud Karaoke.

]]> countrydenverhnreaderjohnkaraokemurderroadsthailand http://revver.com/video/1356232/karaoke-murders/ http://revver.com/watch/1356232 Karaoke Murders A man in Thailand shot and killed eight of his neighbors... because he couldn't stand their loud Karaoke. A man in Thailand shot and killed eight of his neighbors... because he couldn't stand their loud Karaoke. HotNewzTV HotNewzTV country denver hnreader john karaoke murder roads thailand nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Lucky Magazine: Three Essentials Wed, 03 Dec 2008 18:52:37 -0800

Author: HotNewzTV
Added: Wed, 03 Dec 2008 18:52:37 -0800
Duration: 59

Three must-have beauty products from Lucky Magazine.

]]> bigelowblastcovercristinaexactgirlglosshnexpertlaralashlipluckymagazinemascaramenthamerciermoisturizermuellershinetinted http://revver.com/video/1356233/lucky-magazine-three-essentials/ http://revver.com/watch/1356233 Lucky Magazine: Three Essentials Three must-have beauty products from Lucky Magazine. Three must-have beauty products from Lucky Magazine. HotNewzTV HotNewzTV bigelow blast cover cristina exact girl gloss hnexpert lara lash lip lucky magazine mascara mentha mercier moisturizer mueller shine tinted nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ College News: December 2, 2008 Tue, 02 Dec 2008 12:33:31 -0800

Author: HotNewzTV
Added: Tue, 02 Dec 2008 12:33:31 -0800
Duration: 75

Top stories from college campuses including a study that shows that eating disorders are linked to stress, a tech war brewing at Victoria's Secret, and students at the University of Florida are raising awareness about wasting food.

]]> collegedisorderseatingfloridafoodhncollegeminnesotanewssecretstresstechuniversityvictoriasvictoriassecretcomwarwasting http://revver.com/video/1354499/college-news-december-2-2008/ http://revver.com/watch/1354499 College News: December 2, 2008 Top stories from college campuses including a study that shows that eating disorders are linked to stress, a tech war brewing at Victoria's Secret, and students at the University of Florida are raising awareness about wasting food. Top stories from college campuses including a study that shows that eating disorders are linked to stress, a tech war brewing at Victoria's Secret, and students at the University of Florida are raising awareness about wasting food. HotNewzTV HotNewzTV college disorders eating florida food hncollege minnesota news secret stress tech university victorias victoriassecretcom war wasting nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Are You Freakin' Kidding Me!? World's Largest Swimming Pool Tue, 02 Dec 2008 12:33:31 -0800

Author: HotNewzTV
Added: Tue, 02 Dec 2008 12:33:31 -0800
Duration: 27

Chlorine-makers of the world, rejoice! The world's largest swimming pool has opened in Chile. It's longer than 11 football fields.

]]> chilefieldfootballguinnesshnkiddingpoolrecordwater http://revver.com/video/1354500/are-you-freakin-kidding-me-worlds-largest-swimming-pool/ http://revver.com/watch/1354500 Are You Freakin' Kidding Me!? World's Largest Swimming Pool Chlorine-makers of the world, rejoice! The world's largest swimming pool has opened in Chile. It's longer than 11 football fields. Chlorine-makers of the world, rejoice! The world's largest swimming pool has opened in Chile. It's longer than 11 football fields. HotNewzTV HotNewzTV chile field football guinness hnkidding pool record water nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Hot Tunes: December 2, 2008 Tue, 02 Dec 2008 12:33:31 -0800

Author: HotNewzTV
Added: Tue, 02 Dec 2008 12:33:31 -0800
Duration: 44

We've only got one album on our mind this week... Britney Spears debuts "Circus."

]]> albumbritneycircushnmusicreleasesspears http://revver.com/video/1354502/hot-tunes-december-2-2008/ http://revver.com/watch/1354502 Hot Tunes: December 2, 2008 We've only got one album on our mind this week... Britney Spears debuts "Circus." We've only got one album on our mind this week... Britney Spears debuts "Circus." HotNewzTV HotNewzTV album britney circus hnmusic releases spears nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Leadership Spotlight: Cecelia Thompson Tue, 02 Dec 2008 12:33:31 -0800

Author: HotNewzTV
Added: Tue, 02 Dec 2008 12:33:31 -0800
Duration: 52

The American Express Leadership Spotlight shines on Cecelia Thompson and her work with the Guilford Green Foundation promoting gay and lesbian organizations in North Carolina.

]]> americanamexceceliaexpressfoundationgaygreenguilfordhnamexleadershiplesbianorganizationspotlightthompson http://revver.com/video/1354503/leadership-spotlight-cecelia-thompson/ http://revver.com/watch/1354503 Leadership Spotlight: Cecelia Thompson The American Express Leadership Spotlight shines on Cecelia Thompson and her work with the Guilford Green Foundation promoting gay and lesbian organizations in North Carolina. The American Express Leadership Spotlight shines on Cecelia Thompson and her work with the Guilford Green Foundation promoting gay and lesbian organizations in North Carolina. HotNewzTV HotNewzTV american amex cecelia express foundation gay green guilford hnamex leadership lesbian organization spotlight thompson nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Meth Mail Mon, 01 Dec 2008 00:33:22 -0800

Author: HotNewzTV
Added: Mon, 01 Dec 2008 00:33:22 -0800
Duration: 20

A man in Alabama is arrested after discarding his meth lab equipment with his mail.

]]> alabamaawardcrystaldarwindrugequipmenthnreadermailmethpolice http://revver.com/video/1351373/meth-mail/ http://revver.com/watch/1351373 Meth Mail A man in Alabama is arrested after discarding his meth lab equipment with his mail. A man in Alabama is arrested after discarding his meth lab equipment with his mail. HotNewzTV HotNewzTV alabama award crystal darwin drug equipment hnreader mail meth police nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Campus Camera: Can a President Make Meaningful Changes? Mon, 01 Dec 2008 00:33:22 -0800

Author: HotNewzTV
Added: Mon, 01 Dec 2008 00:33:22 -0800
Duration: 68

The election is over and inauguration is right around the corner, so do you think a president can make meaningful changes?

]]> changegovermenthncollegeopinionpresidentstudent http://revver.com/video/1351374/campus-camera-can-a-president-make-meaningful-changes/ http://revver.com/watch/1351374 Campus Camera: Can a President Make Meaningful Changes? The election is over and inauguration is right around the corner, so do you think a president can make meaningful changes? The election is over and inauguration is right around the corner, so do you think a president can make meaningful changes? HotNewzTV HotNewzTV change goverment hncollege opinion president student nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Scholarship: Seven Mon, 01 Dec 2008 00:33:22 -0800

Author: HotNewzTV
Added: Mon, 01 Dec 2008 00:33:22 -0800
Duration: 38

The Seven Fund is an organization dedicated to fighting global poverty, and they want to give you $10,000. All you have to do is a little role playing.

]]> fundhnscholarshippovertypresidentrwanadascholarshipseven http://revver.com/video/1351375/scholarship-seven/ http://revver.com/watch/1351375 Scholarship: Seven The Seven Fund is an organization dedicated to fighting global poverty, and they want to give you $10,000. All you have to do is a little role playing. The Seven Fund is an organization dedicated to fighting global poverty, and they want to give you $10,000. All you have to do is a little role playing. HotNewzTV HotNewzTV fund hnscholarship poverty president rwanada scholarship seven nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Need to Know: Ebay Trick Mon, 01 Dec 2008 00:33:22 -0800

Author: HotNewzTV
Added: Mon, 01 Dec 2008 00:33:22 -0800
Duration: 26

Unloading something on Ebay? Here's a scheduling trick you need to know.

]]> auctionbiddingbuyingebayhnn2ksellingsunday http://revver.com/video/1351376/need-to-know-ebay-trick/ http://revver.com/watch/1351376 Need to Know: Ebay Trick Unloading something on Ebay? Here's a scheduling trick you need to know. Unloading something on Ebay? Here's a scheduling trick you need to know. HotNewzTV HotNewzTV auction bidding buying ebay hnn2k selling sunday nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Sleep Doctor: Turkey Wed, 26 Nov 2008 17:52:39 -0800

Author: HotNewzTV
Added: Wed, 26 Nov 2008 17:52:39 -0800
Duration: 35

Our resident sleep doctor is busting the myth that Turkey makes you sleepy.

]]> breushnexpertmichaelproteinsleeptryptophanturkey http://revver.com/video/1342283/sleep-doctor-turkey/ http://revver.com/watch/1342283 Sleep Doctor: Turkey Our resident sleep doctor is busting the myth that Turkey makes you sleepy. Our resident sleep doctor is busting the myth that Turkey makes you sleepy. HotNewzTV HotNewzTV breus hnexpert michael protein sleep tryptophan turkey nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Need to Know: Online Jobs Wed, 26 Nov 2008 17:52:39 -0800

Author: HotNewzTV
Added: Wed, 26 Nov 2008 17:52:39 -0800
Duration: 46

An exciting new trend in the workforce could land you a paycheck, all thanks to Facebook.

]]> facebookhnn2kinternetjobsmarketingmediamoneymyspacenetworkingonline http://revver.com/video/1342284/need-to-know-online-jobs/ http://revver.com/watch/1342284 Need to Know: Online Jobs An exciting new trend in the workforce could land you a paycheck, all thanks to Facebook. An exciting new trend in the workforce could land you a paycheck, all thanks to Facebook. HotNewzTV HotNewzTV facebook hnn2k internet jobs marketing media money myspace networking online nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Alt Beats: I'm From Barcelona Wed, 26 Nov 2008 17:52:39 -0800

Author: HotNewzTV
Added: Wed, 26 Nov 2008 17:52:39 -0800
Duration: 66

Indie blogger Abbey Braden introduces us to "I'm From Barcelona," a 28-member band. Whoa.

]]> 28abbeybandbarcelonabradenfromharryhnmusichoudiniimkilledmemberswho http://revver.com/video/1342286/alt-beats-im-from-barcelona/ http://revver.com/watch/1342286 Alt Beats: I'm From Barcelona Indie blogger Abbey Braden introduces us to "I'm From Barcelona," a 28-member band. Whoa. Indie blogger Abbey Braden introduces us to "I'm From Barcelona," a 28-member band. Whoa. HotNewzTV HotNewzTV 28 abbey band barcelona braden from harry hnmusic houdini im killed members who nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Hot Tunes: November 25, 2008 Tue, 25 Nov 2008 10:31:45 -0800

Author: HotNewzTV
Added: Tue, 25 Nov 2008 10:31:45 -0800
Duration: 71

Check out new music released this week from The Killers, Tom Jones, and David Byrne & Brian Eno.

]]> &24agebrianbrynedaviddayenoeverythinghappenhappenshnmusichoursjoneskillersthatthetodaytomwill http://revver.com/video/1340164/hot-tunes-november-25-2008/ http://revver.com/watch/1340164 Hot Tunes: November 25, 2008 Check out new music released this week from The Killers, Tom Jones, and David Byrne & Brian Eno. Check out new music released this week from The Killers, Tom Jones, and David Byrne & Brian Eno. HotNewzTV HotNewzTV & 24 age brian bryne david day eno everything happen happens hnmusic hours jones killers that the today tom will nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Cosmo: First Kiss Tue, 25 Nov 2008 10:31:45 -0800

Author: HotNewzTV
Added: Tue, 25 Nov 2008 10:31:45 -0800
Duration: 25

What to do if he doesn't go in for the first kiss.

]]> advicecosmocosmopolitandatefirsthnexpertkisslesleymagazine http://revver.com/video/1340165/cosmo-first-kiss/ http://revver.com/watch/1340165 Cosmo: First Kiss What to do if he doesn't go in for the first kiss. What to do if he doesn't go in for the first kiss. HotNewzTV HotNewzTV advice cosmo cosmopolitan date first hnexpert kiss lesley magazine nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Leadership Spotlight: Carlos Galindo-Elvira Tue, 25 Nov 2008 10:31:45 -0800

Author: HotNewzTV
Added: Tue, 25 Nov 2008 10:31:45 -0800
Duration: 58

The American Express Leadership Spotlight shines on Carlos Galindo-Elvira for his work with Valle del Sol, a nonprofit in Arizona.

]]> [link-http//wwwamericanexpretitleid=3141401001 http://revver.com/video/1340166/leadership-spotlight-carlos-galindo-elvira/ http://revver.com/watch/1340166 Leadership Spotlight: Carlos Galindo-Elvira The American Express Leadership Spotlight shines on Carlos Galindo-Elvira for his work with Valle del Sol, a nonprofit in Arizona. The American Express Leadership Spotlight shines on Carlos Galindo-Elvira for his work with Valle del Sol, a nonprofit in Arizona. HotNewzTV HotNewzTV [link-http//wwwamericanexpre titleid=3141401001 nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ College News: November 25, 2008 Tue, 25 Nov 2008 10:31:45 -0800

Author: HotNewzTV
Added: Tue, 25 Nov 2008 10:31:45 -0800
Duration: 57

Top stories from college campuses including the Princeton chess club playing against inmates, two NC State students apologize for racist remarks, and the University of Maine competes in the Global Innovation Tournament.

]]> barackcarolinachessclubexpressionfreeglobalhncollegeinnovationjerseymainenewnorthobamaprincetonprisonstatetournamenttunneluniversity http://revver.com/video/1340167/college-news-november-25-2008/ http://revver.com/watch/1340167 College News: November 25, 2008 Top stories from college campuses including the Princeton chess club playing against inmates, two NC State students apologize for racist remarks, and the University of Maine competes in the Global Innovation Tournament. Top stories from college campuses including the Princeton chess club playing against inmates, two NC State students apologize for racist remarks, and the University of Maine competes in the Global Innovation Tournament. HotNewzTV HotNewzTV barack carolina chess club expression free global hncollege innovation jersey maine new north obama princeton prison state tournament tunnel university nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Are You Freakin' Kidding Me!?: Hot Keys Mon, 24 Nov 2008 13:52:36 -0800

Author: HotNewzTV
Added: Mon, 24 Nov 2008 13:52:36 -0800
Duration: 28

A rather hot piano performance by Yosuke Yamashita... a jazz pianist who often plays on a burning piano.

]]> firefirefighterhnkiddingjazzpianistpianoyamashitayosuke http://revver.com/video/1337817/are-you-freakin-kidding-me-hot-keys/ http://revver.com/watch/1337817 Are You Freakin' Kidding Me!?: Hot Keys A rather hot piano performance by Yosuke Yamashita... a jazz pianist who often plays on a burning piano. A rather hot piano performance by Yosuke Yamashita... a jazz pianist who often plays on a burning piano. HotNewzTV HotNewzTV fire firefighter hnkidding jazz pianist piano yamashita yosuke nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Craigslist Prank Mon, 24 Nov 2008 13:52:36 -0800

Author: HotNewzTV
Added: Mon, 24 Nov 2008 13:52:36 -0800
Duration: 40

A prank goes terribly wrong!

]]> craigslistfloridahnreaderhorsehousejacksonvillemoveprank http://revver.com/video/1337818/craigslist-prank/ http://revver.com/watch/1337818 Craigslist Prank A prank goes terribly wrong! A prank goes terribly wrong! HotNewzTV HotNewzTV craigslist florida hnreader horse house jacksonville move prank nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Campus Camera: What are you thankful for? Mon, 24 Nov 2008 13:52:36 -0800

Author: HotNewzTV
Added: Mon, 24 Nov 2008 13:52:36 -0800
Duration: 68

The turkey is roasted, the cranberries are jellied and the potatoes are mashed. So what are you thankful for?

]]> collegehncollegeopinionstudentthankfulthanksgiving http://revver.com/video/1337819/campus-camera-what-are-you-thankful-for/ http://revver.com/watch/1337819 Campus Camera: What are you thankful for? The turkey is roasted, the cranberries are jellied and the potatoes are mashed. So what are you thankful for? The turkey is roasted, the cranberries are jellied and the potatoes are mashed. So what are you thankful for? HotNewzTV HotNewzTV college hncollege opinion student thankful thanksgiving nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Fashion Fix: Celebrity Lines Mon, 24 Nov 2008 13:52:36 -0800

Author: HotNewzTV
Added: Mon, 24 Nov 2008 13:52:36 -0800
Duration: 57

HotNewz staffer's favorite celebrity fashion lines!

]]> ashleycarlosclothesconradelizabethhnfashionjamesjessicajohnkatelaurenmaryolsensantanaseanshoesshopbopsimpson http://revver.com/video/1337820/fashion-fix-celebrity-lines/ http://revver.com/watch/1337820 Fashion Fix: Celebrity Lines HotNewz staffer's favorite celebrity fashion lines! HotNewz staffer's favorite celebrity fashion lines! HotNewzTV HotNewzTV ashley carlos clothes conrad elizabeth hnfashion james jessica john kate lauren mary olsen santana sean shoes shopbop simpson nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ People Magazine: November 24, 2008 Mon, 24 Nov 2008 13:52:36 -0800

Author: HotNewzTV
Added: Mon, 24 Nov 2008 13:52:36 -0800
Duration: 68

Celebrity gossip from David Caplan at People Magazine including sexiest man alive Hugh Jackman.

]]> aliveaustraliabradcelebritiescraigdanielgossiphnpeoplehughjackmanjustinmanpeoplepittsexiesttimberlakewolverine http://revver.com/video/1337821/people-magazine-november-24-2008/ http://revver.com/watch/1337821 People Magazine: November 24, 2008 Celebrity gossip from David Caplan at People Magazine including sexiest man alive Hugh Jackman. Celebrity gossip from David Caplan at People Magazine including sexiest man alive Hugh Jackman. HotNewzTV HotNewzTV alive australia brad celebrities craig daniel gossip hnpeople hugh jackman justin man people pitt sexiest timberlake wolverine nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Need to Know: Weighty News Fri, 21 Nov 2008 17:52:38 -0800

Author: HotNewzTV
Added: Fri, 21 Nov 2008 17:52:38 -0800
Duration: 31

New research says that overweight people live longer than normal weight people.

]]> deathexpectancyfathealthhnn2klifeobeseoverweightratestudythin http://revver.com/video/1332248/need-to-know-weighty-news/ http://revver.com/watch/1332248 Need to Know: Weighty News New research says that overweight people live longer than normal weight people. New research says that overweight people live longer than normal weight people. HotNewzTV HotNewzTV death expectancy fat health hnn2k life obese overweight rate study thin nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Inc.com: Dorm Room CEOs Fri, 21 Nov 2008 17:52:38 -0800

Author: HotNewzTV
Added: Fri, 21 Nov 2008 17:52:38 -0800
Duration: 66

While their classmates were out chugging beers, these guys were developing their own businesses. Rod Kurtz has a look at INC's Dorm Room CEO's.

]]> collegeboxescomderekdormgregghnexpertinccomkleinowmichigannarayanneurbergerprincetonprintingrishirodroomryanscotttigergpscomundergrounduniversitywashington http://revver.com/video/1332249/inccom-dorm-room-ceos/ http://revver.com/watch/1332249 Inc.com: Dorm Room CEOs While their classmates were out chugging beers, these guys were developing their own businesses. Rod Kurtz has a look at INC's Dorm Room CEO's. While their classmates were out chugging beers, these guys were developing their own businesses. Rod Kurtz has a look at INC's Dorm Room CEO's. HotNewzTV HotNewzTV collegeboxescom derek dorm gregg hnexpert inccom kleinow michigan narayan neurberger princeton printing rishi rod room ryan scott tigergpscom underground university washington nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Swarovski Holiday Kickoff Report Part 3 Fri, 21 Nov 2008 17:52:38 -0800

Author: HotNewzTV
Added: Fri, 21 Nov 2008 17:52:38 -0800
Duration: 72

One of the ways you know Christmas is coming is that Swarovski unveils its 550-pound star for the top of the Rockefeller Center Christmas tree. This year, Grammy award winner and fashion icon Fergie did the honors.

]]> backblingcharitychristmasclothesfergiehnpackageholidayjewleryoffourstarsswarovskitree http://revver.com/video/1332250/swarovski-holiday-kickoff-report-part-3/ http://revver.com/watch/1332250 Swarovski Holiday Kickoff Report Part 3 One of the ways you know Christmas is coming is that Swarovski unveils its 550-pound star for the top of the Rockefeller Center Christmas tree. This year, Grammy award winner and fashion icon Fergie did the honors. One of the ways you know Christmas is coming is that Swarovski unveils its 550-pound star for the top of the Rockefeller Center Christmas tree. This year, Grammy award winner and fashion icon Fergie did the honors. HotNewzTV HotNewzTV back bling charity christmas clothes fergie hnpackage holiday jewlery off our stars swarovski tree nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Are You Freakin' Kidding Me!?: Tallest Man Fri, 21 Nov 2008 17:52:38 -0800

Author: HotNewzTV
Added: Fri, 21 Nov 2008 17:52:38 -0800
Duration: 35

The gift the president of Ukraine gave the world's tallest man.

]]> carchevyhnkiddingleonidmanpresidentstadnyktallestukraineviktoryushchenko http://revver.com/video/1332251/are-you-freakin-kidding-me-tallest-man/ http://revver.com/watch/1332251 Are You Freakin' Kidding Me!?: Tallest Man The gift the president of Ukraine gave the world's tallest man. The gift the president of Ukraine gave the world's tallest man. HotNewzTV HotNewzTV car chevy hnkidding leonid man president stadnyk tallest ukraine viktor yushchenko nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Now Playing: November 21, 2008 Fri, 21 Nov 2008 17:52:38 -0800

Author: HotNewzTV
Added: Fri, 21 Nov 2008 17:52:38 -0800
Duration: 84

Check out what's new in theaters this weekend including the much anticipated Twilight and Robert Downey Jr's new flick, "The Soloist."

]]> downeyfoxxhnmoviesjamiejrrobertsoloistthetwilight http://revver.com/video/1332252/now-playing-november-21-2008/ http://revver.com/watch/1332252 Now Playing: November 21, 2008 Check out what's new in theaters this weekend including the much anticipated Twilight and Robert Downey Jr's new flick, "The Soloist." Check out what's new in theaters this weekend including the much anticipated Twilight and Robert Downey Jr's new flick, "The Soloist." HotNewzTV HotNewzTV downey foxx hnmovies jamie jr robert soloist the twilight nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Need to Know: Grad Income Wed, 19 Nov 2008 15:53:56 -0800

Author: HotNewzTV
Added: Wed, 19 Nov 2008 15:53:56 -0800
Duration: 33

Despite a weak economy, college grads are making good money.

]]> artschemicalcomputereconomyemployeesengineeringhnn2kliberalmoneyrecessionsalarysciencestarting http://revver.com/video/1328011/need-to-know-grad-income/ http://revver.com/watch/1328011 Need to Know: Grad Income Despite a weak economy, college grads are making good money. Despite a weak economy, college grads are making good money. HotNewzTV HotNewzTV arts chemical computer economy employees engineering hnn2k liberal money recession salary science starting nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Body Language: Gauging Attraction Wed, 19 Nov 2008 15:53:56 -0800

Author: HotNewzTV
Added: Wed, 19 Nov 2008 15:53:56 -0800
Duration: 50

How to tell through body language if someone is attracted to you...

]]> attractionbodycrushgreghartleyhnexpertlanguage http://revver.com/video/1328012/body-language-gauging-attraction/ http://revver.com/watch/1328012 Body Language: Gauging Attraction How to tell through body language if someone is attracted to you... How to tell through body language if someone is attracted to you... HotNewzTV HotNewzTV attraction body crush greg hartley hnexpert language nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Cosmo: Silence Wed, 19 Nov 2008 15:53:56 -0800

Author: HotNewzTV
Added: Wed, 19 Nov 2008 15:53:56 -0800
Duration: 19

It's not always a bad sign when your guy is quiet.

]]> cosmocosmopolitandatinghnexpertmagazinetips http://revver.com/video/1328013/cosmo-silence/ http://revver.com/watch/1328013 Cosmo: Silence It's not always a bad sign when your guy is quiet. It's not always a bad sign when your guy is quiet. HotNewzTV HotNewzTV cosmo cosmopolitan dating hnexpert magazine tips nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Swarovski Holiday Kickoff Part 2 Wed, 19 Nov 2008 15:53:56 -0800

Author: HotNewzTV
Added: Wed, 19 Nov 2008 15:53:56 -0800
Duration: 62

Swarovski Crystal made the giant star for the Rockefeller Center Christmas tree in New York City. Fergie introduces the hollywood celebrities that had chance to create their own ornaments.

]]> backcharityclothesdegeneresellenfergiegarnerhatcherhnentertainmentjenniferoffourswarovskiterri http://revver.com/video/1328014/swarovski-holiday-kickoff-part-2/ http://revver.com/watch/1328014 Swarovski Holiday Kickoff Part 2 Swarovski Crystal made the giant star for the Rockefeller Center Christmas tree in New York City. Fergie introduces the hollywood celebrities that had chance to create their own ornaments. Swarovski Crystal made the giant star for the Rockefeller Center Christmas tree in New York City. Fergie introduces the hollywood celebrities that had chance to create their own ornaments. HotNewzTV HotNewzTV back charity clothes degeneres ellen fergie garner hatcher hnentertainment jennifer off our swarovski terri nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Training Reels: Couchsurfing Wed, 19 Nov 2008 15:53:56 -0800

Author: HotNewzTV
Added: Wed, 19 Nov 2008 15:53:56 -0800
Duration: 151

Student Reporter Sebastian Robertson from Gonzaga University reports on couchsurfing.com.

]]> couchsurfingcomgonzagahntrainingrobertsonsebastiantraveluniversity http://revver.com/video/1328015/training-reels-couchsurfing/ http://revver.com/watch/1328015 Training Reels: Couchsurfing Student Reporter Sebastian Robertson from Gonzaga University reports on couchsurfing.com. Student Reporter Sebastian Robertson from Gonzaga University reports on couchsurfing.com. HotNewzTV HotNewzTV couchsurfingcom gonzaga hntraining robertson sebastian travel university nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Need to Know: Top Issues Tue, 18 Nov 2008 11:52:40 -0800

Author: HotNewzTV
Added: Tue, 18 Nov 2008 11:52:40 -0800
Duration: 32

The Panetta Institute for public policy recently asked college students which political issues concerned them the most.

]]> carecollegeeducationforhealthhnn2kinstituteiraqissuejobspanettapolicypoliticalpublicsystemwar http://revver.com/video/1325552/need-to-know-top-issues/ http://revver.com/watch/1325552 Need to Know: Top Issues The Panetta Institute for public policy recently asked college students which political issues concerned them the most. The Panetta Institute for public policy recently asked college students which political issues concerned them the most. HotNewzTV HotNewzTV care college education for health hnn2k institute iraq issue jobs panetta policy political public system war nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Are You Freaking Kidding Me?! Cop Rug Tue, 18 Nov 2008 11:52:40 -0800

Author: HotNewzTV
Added: Tue, 18 Nov 2008 11:52:40 -0800
Duration: 35

Cops in India are trying to improve their public image... by making a huge rug out of flowers.

]]> copsflowershnkiddingimageindiapolicerug http://revver.com/video/1325553/are-you-freaking-kidding-me-cop-rug/ http://revver.com/watch/1325553 Are You Freaking Kidding Me?! Cop Rug Cops in India are trying to improve their public image... by making a huge rug out of flowers. Cops in India are trying to improve their public image... by making a huge rug out of flowers. HotNewzTV HotNewzTV cops flowers hnkidding image india police rug nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/