Videos by Jaketvee Videos by Jaketvee http://revver.com/u/Jaketvee/ http://revver.com webmaster@revver.com Canon MD205 Camcorder Unboxing Fri, 11 Jul 2008 04:34:32 -0800

Author: Jaketvee
Added: Fri, 11 Jul 2008 04:34:32 -0800
Duration: 472

The unboxing of our new video camera - only to replace our old broken one, it's nothing special.

]]> camcordercameracanonmd205minidvunboxingvideo http://revver.com/video/1031009/canon-md205-camcorder-unboxing/ http://revver.com/watch/1031009 Canon MD205 Camcorder Unboxing The unboxing of our new video camera - only to replace our old broken one, it's nothing special. The unboxing of our new video camera - only to replace our old broken one, it's nothing special. Jaketvee Jaketvee camcorder camera canon md205 minidv unboxing video nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Firefox 3 Review Fri, 20 Jun 2008 04:39:30 -0800

Author: Jaketvee
Added: Fri, 20 Jun 2008 04:39:30 -0800
Duration: 273

My thoughts and opinions on the new version of the loved web browser, Firefox 3.

]]> 3browsercomputersdaydownloadfastfeaturesfirefoxfreeicantthinkofanymoretagsinterfacemozillaopensourceopinionsreviewsafaritechvideowebwebbrowser http://revver.com/video/973550/firefox-3-review/ http://revver.com/watch/973550 Firefox 3 Review My thoughts and opinions on the new version of the loved web browser, Firefox 3. My thoughts and opinions on the new version of the loved web browser, Firefox 3. Jaketvee Jaketvee 3 browser computers day download fast features firefox free icantthinkofanymoretags interface mozilla opensource opinions review safari tech video web webbrowser nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Alternatives to Microsoft Office! Tue, 17 Jun 2008 17:05:01 -0800

Author: Jaketvee
Added: Tue, 17 Jun 2008 17:05:01 -0800
Duration: 564

Stop! Don't buy Microsoft Office. There are alternatives.

]]> 20032007downloadfreemicrosoftneoofficeofficeopenopenofficeopensourcesource http://revver.com/video/967223/alternatives-to-microsoft-office/ http://revver.com/watch/967223 Alternatives to Microsoft Office! Stop! Don't buy Microsoft Office. There are alternatives. Stop! Don't buy Microsoft Office. There are alternatives. Jaketvee Jaketvee 2003 2007 download free microsoft neooffice office open openoffice opensource source nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ What do you want from jak-e.com? Mon, 16 Jun 2008 16:42:14 -0800

Author: Jaketvee
Added: Mon, 16 Jun 2008 16:42:14 -0800
Duration: 219

After being online for nearly 6 months, I thought it was time to give jak-e.com a new look and add some new features. While I was choosing what to put on the home page, I decided to ask the community, the people who visit the website, what they would ...

]]> communitydesignexpectfeaturesjak-e.commyonlineseewantwebsitewhat http://revver.com/video/963829/what-do-you-want-from-jak-ecom/ http://revver.com/watch/963829 What do you want from jak-e.com? After being online for nearly 6 months, I thought it was time to give jak-e.com a new look and add some new features. While I was choosing what to put on the home page, I decided to ask the community, the people who visit the website, what they would ... After being online for nearly 6 months, I thought it was time to give jak-e.com a new look and add some new features. While I was choosing what to put on the home page, I decided to ask the community, the people who visit the website, what they would ... Jaketvee Jaketvee community design expect features jak-e.com my online see want website what nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Why I'm Upgrading to XP! Mon, 16 Jun 2008 10:20:11 -0800

Author: Jaketvee
Added: Mon, 16 Jun 2008 10:20:11 -0800
Duration: 347

Vista has gone too far! I'm going back to XP before I throw the computer out of the window!

]]> annoyingbackbadcontroldowngradingfromgoingimpaneltouacupgradingvistawhyxp http://revver.com/video/961400/why-im-upgrading-to-xp/ http://revver.com/watch/961400 Why I'm Upgrading to XP! Vista has gone too far! I'm going back to XP before I throw the computer out of the window! Vista has gone too far! I'm going back to XP before I throw the computer out of the window! Jaketvee Jaketvee annoying back bad control downgrading from going im panel to uac upgrading vista why xp nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ How to Keep your Mac mini Cool Sun, 15 Jun 2008 01:06:09 -0800

Author: Jaketvee
Added: Sun, 15 Jun 2008 01:06:09 -0800
Duration: 59

If you have ever used a Mac mini for an extended period of time, then you will have noticed that it can get quite warm. Since mine is running 24/7 and gets extremely hot, I was forced to find a way to keep it cool, so here is a simple trick to make ...

]]> coldcooldownhothowtokeepmacminitemperature http://revver.com/video/949063/how-to-keep-your-mac-mini-cool/ http://revver.com/watch/949063 How to Keep your Mac mini Cool If you have ever used a Mac mini for an extended period of time, then you will have noticed that it can get quite warm. Since mine is running 24/7 and gets extremely hot, I was forced to find a way to keep it cool, so here is a simple trick to make ... If you have ever used a Mac mini for an extended period of time, then you will have noticed that it can get quite warm. Since mine is running 24/7 and gets extremely hot, I was forced to find a way to keep it cool, so here is a simple trick to make ... Jaketvee Jaketvee cold cool down hot howto keep mac mini temperature nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Auto Tweets with twitterfeed Sat, 14 Jun 2008 15:45:59 -0800

Author: Jaketvee
Added: Sat, 14 Jun 2008 15:45:59 -0800
Duration: 248

Using twitterfeed, you can automatically have the titles and/or descriptions of your latest blog posts or videos (or anything with an RSS feed) posted to Twitter. This is a great way to tell people about your latest content. http://twitterfeed.com

]]> autoautomaticbotcontentfeedsfreelatestpostpublishreadrobotrsssharetweetstwittertwitterfeedviewersviews http://revver.com/video/959506/auto-tweets-with-twitterfeed/ http://revver.com/watch/959506 Auto Tweets with twitterfeed Using twitterfeed, you can automatically have the titles and/or descriptions of your latest blog posts or videos (or anything with an RSS feed) posted to Twitter. This is a great way to tell people about your latest content. http://twitterfeed.com Using twitterfeed, you can automatically have the titles and/or descriptions of your latest blog posts or videos (or anything with an RSS feed) posted to Twitter. This is a great way to tell people about your latest content. http://twitterfeed.com Jaketvee Jaketvee auto automatic bot content feeds free latest post publish read robot rss share tweets twitter twitterfeed viewers views nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mac mini Review Sat, 14 Jun 2008 15:45:59 -0800

Author: Jaketvee
Added: Sat, 14 Jun 2008 15:45:59 -0800
Duration: 366

It's been awhile since I got my Mac mini, so I've had plenty of time to use and get used to it. So without further ado, here is my review on it!

]]> computerinexpensivejak-ejak-etveejakejaketveemacminireviewsmall http://revver.com/video/948371/mac-mini-review/ http://revver.com/watch/948371 Mac mini Review It's been awhile since I got my Mac mini, so I've had plenty of time to use and get used to it. So without further ado, here is my review on it! It's been awhile since I got my Mac mini, so I've had plenty of time to use and get used to it. So without further ado, here is my review on it! Jaketvee Jaketvee computer inexpensive jak-e jak-etvee jake jaketvee mac mini review small nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Windows 7 or Snow Leopard? Sat, 14 Jun 2008 15:45:59 -0800

Author: Jaketvee
Added: Sat, 14 Jun 2008 15:45:59 -0800
Duration: 274

The current version of Windows is Vista and the current version Mac OS X is version 10.6 which is called leopard. The next versions of these operating systems are Windows 7 and Snow Leopard (Mac OS X 10.6). Which one are you more excited about?

]]> 10.510.67leopardmacossnowvistawindowsx http://revver.com/video/957396/windows-7-or-snow-leopard/ http://revver.com/watch/957396 Windows 7 or Snow Leopard? The current version of Windows is Vista and the current version Mac OS X is version 10.6 which is called leopard. The next versions of these operating systems are Windows 7 and Snow Leopard (Mac OS X 10.6). Which one are you more excited about? The current version of Windows is Vista and the current version Mac OS X is version 10.6 which is called leopard. The next versions of these operating systems are Windows 7 and Snow Leopard (Mac OS X 10.6). Which one are you more excited about? Jaketvee Jaketvee 10.5 10.6 7 leopard mac os snow vista windows x nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ LogMeIn or Teamviewer? Fri, 13 Jun 2008 03:07:36 -0800

Author: Jaketvee
Added: Fri, 13 Jun 2008 03:07:36 -0800
Duration: 136

Is TeamViewer better than LogMeIn?

]]> browsercomputercontrolcontrollingfreeinstalllogmeinnothingremotesoftwareteamviewerweb http://revver.com/video/955916/logmein-or-teamviewer/ http://revver.com/watch/955916 LogMeIn or Teamviewer? Is TeamViewer better than LogMeIn? Is TeamViewer better than LogMeIn? Jaketvee Jaketvee browser computer control controlling free install logmein nothing remote software teamviewer web nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Is Vista Really So Bad? Thu, 12 Jun 2008 00:46:14 -0800

Author: Jaketvee
Added: Thu, 12 Jun 2008 00:46:14 -0800
Duration: 249

Yes! When you get two blue screens before it has even installed the you know that Vista is not going to be the best OS you've ever used!

]]> badbluebsodgoodhomeinstallationmicrosoftpremiumscreenupgradevistawindowsxp http://revver.com/video/952982/is-vista-really-so-bad/ http://revver.com/watch/952982 Is Vista Really So Bad? Yes! When you get two blue screens before it has even installed the you know that Vista is not going to be the best OS you've ever used! Yes! When you get two blue screens before it has even installed the you know that Vista is not going to be the best OS you've ever used! Jaketvee Jaketvee bad blue bsod good home installation microsoft premium screen upgrade vista windows xp nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Apple Wireless Mighty Mouse Unboxing Tue, 10 Jun 2008 16:46:17 -0800

Author: Jaketvee
Added: Tue, 10 Jun 2008 16:46:17 -0800
Duration: 473

To match my Apple wireless keyboard, I bought a wireless mighty mouse. Is it worth £50?

]]> applemightymousereviewunboxingwireless http://revver.com/video/947449/apple-wireless-mighty-mouse-unboxing/ http://revver.com/watch/947449 Apple Wireless Mighty Mouse Unboxing To match my Apple wireless keyboard, I bought a wireless mighty mouse. Is it worth £50? To match my Apple wireless keyboard, I bought a wireless mighty mouse. Is it worth £50? Jaketvee Jaketvee apple mighty mouse review unboxing wireless nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Remote Controlling a Computer for Free (How To) Fri, 06 Jun 2008 16:34:49 -0800

Author: Jaketvee
Added: Fri, 06 Jun 2008 16:34:49 -0800
Duration: 176

Have you ever tried to give remote assistance to a friend or relative when they've had a problem with their computer? If you have then you'll know it's quite a challenge. With Teamviewer, available for free from http://teamviewer.com, you can connect ...

]]> assistancecomputercontrolcontrollingfilehowtomacospcpresentationremoteteamviewertransfertutorialwindowsx http://revver.com/video/941258/remote-controlling-a-computer-for-free-how-to/ http://revver.com/watch/941258 Remote Controlling a Computer for Free (How To) Have you ever tried to give remote assistance to a friend or relative when they've had a problem with their computer? If you have then you'll know it's quite a challenge. With Teamviewer, available for free from http://teamviewer.com, you can connect ... Have you ever tried to give remote assistance to a friend or relative when they've had a problem with their computer? If you have then you'll know it's quite a challenge. With Teamviewer, available for free from http://teamviewer.com, you can connect ... Jaketvee Jaketvee assistance computer control controlling file howto mac os pc presentation remote teamviewer transfer tutorial windows x nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Firefox Download Day 2008 Thu, 05 Jun 2008 16:52:34 -0800

Author: Jaketvee
Added: Thu, 05 Jun 2008 16:52:34 -0800
Duration: 198

Help Mozilla set a world record by participating in Download Day on the day Firefox 3 is released. Just visit http://spreadfirefox.com and pledge.

]]> 24daydownloaddownloadsfirefoxhoursmozillaopensourcerecordworld http://revver.com/video/938772/firefox-download-day-2008/ http://revver.com/watch/938772 Firefox Download Day 2008 Help Mozilla set a world record by participating in Download Day on the day Firefox 3 is released. Just visit http://spreadfirefox.com and pledge. Help Mozilla set a world record by participating in Download Day on the day Firefox 3 is released. Just visit http://spreadfirefox.com and pledge. Jaketvee Jaketvee 24 day download downloads firefox hours mozilla opensource record world nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ How to Find the OS X Intro Movie Wed, 04 Jun 2008 15:49:35 -0800

Author: Jaketvee
Added: Wed, 04 Jun 2008 15:49:35 -0800
Duration: 228

Remember that cool movie you saw when you first turned on your Mac? Well now you can watch it until your heart is content!

]]> findintromacmoviemusicossoundthemex http://revver.com/video/935586/how-to-find-the-os-x-intro-movie/ http://revver.com/watch/935586 How to Find the OS X Intro Movie Remember that cool movie you saw when you first turned on your Mac? Well now you can watch it until your heart is content! Remember that cool movie you saw when you first turned on your Mac? Well now you can watch it until your heart is content! Jaketvee Jaketvee find intro mac movie music os sound theme x nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Unboxing & Review FREECOM HDD Classic 500GB Tue, 03 Jun 2008 14:19:32 -0800

Author: Jaketvee
Added: Tue, 03 Jun 2008 14:19:32 -0800
Duration: 461

As I filled my internal HDD on my Mac mini, I was forced to buy an external one. I chose a FREECOM HDD Classic. It's a whopping 500GB! It's really good except for one thing...

]]> classicdriveexternalformattedfreecomhardhddjak-ejaketveemacpcreviewunboxing http://revver.com/video/932569/unboxing-review-freecom-hdd-classic-500gb/ http://revver.com/watch/932569 Unboxing & Review FREECOM HDD Classic 500GB As I filled my internal HDD on my Mac mini, I was forced to buy an external one. I chose a FREECOM HDD Classic. It's a whopping 500GB! It's really good except for one thing... As I filled my internal HDD on my Mac mini, I was forced to buy an external one. I chose a FREECOM HDD Classic. It's a whopping 500GB! It's really good except for one thing... Jaketvee Jaketvee classic drive external formatted freecom hard hdd jak-e jaketvee mac pc review unboxing nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ History Comes to Life for a LegoMan Fri, 30 May 2008 11:19:36 -0800

Author: Jaketvee
Added: Fri, 30 May 2008 11:19:36 -0800
Duration: 32

A little animation I made with Lego. By the way, he is in a museum looking at armour.

]]> animationcartoonfunnyhistorylaughlegolife http://revver.com/video/923264/history-comes-to-life-for-a-legoman/ http://revver.com/watch/923264 History Comes to Life for a LegoMan A little animation I made with Lego. By the way, he is in a museum looking at armour. A little animation I made with Lego. By the way, he is in a museum looking at armour. Jaketvee Jaketvee animation cartoon funny history laugh lego life nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ The best music player/manager Thu, 22 May 2008 12:49:33 -0800

Author: Jaketvee
Added: Thu, 22 May 2008 12:49:33 -0800
Duration: 193

I'm so impressed with iTunes I had to demonstrate how easy it is to use.

]]> besteasiesteasyitunesmanagermusicorganizerplayer http://revver.com/video/906181/the-best-music-playermanager/ http://revver.com/watch/906181 The best music player/manager I'm so impressed with iTunes I had to demonstrate how easy it is to use. I'm so impressed with iTunes I had to demonstrate how easy it is to use. Jaketvee Jaketvee best easiest easy itunes manager music organizer player nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Trampolining Competition Fri, 02 May 2008 15:58:39 -0800

Author: Jaketvee
Added: Fri, 02 May 2008 15:58:39 -0800
Duration: 33

Watching this video will probably be a waste of time. The only reason I have uploaded it it because a few people have asked me to, and it is the only one I could find. It's definitely not one of my best routines. It is really short and yes, my Dad ...

]]> (competition)(routine)(schools)(somersaults)(trampoline)(trampolining) http://revver.com/video/859645/trampolining-competition/ http://revver.com/watch/859645 Trampolining Competition Watching this video will probably be a waste of time. The only reason I have uploaded it it because a few people have asked me to, and it is the only one I could find. It's definitely not one of my best routines. It is really short and yes, my Dad ... Watching this video will probably be a waste of time. The only reason I have uploaded it it because a few people have asked me to, and it is the only one I could find. It's definitely not one of my best routines. It is really short and yes, my Dad ... Jaketvee Jaketvee (competition) (routine) (schools) (somersaults) (trampoline) (trampolining) nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Apple Wireless Keyboard Unboxing and Review Mon, 28 Apr 2008 05:49:32 -0800

Author: Jaketvee
Added: Mon, 28 Apr 2008 05:49:32 -0800
Duration: 762

The unboxing and my first thoughts of my new Apple wireless Keyboard.

]]> applebestfirstkeyboardnewreviewstylishthoughtsunboxingwireless http://revver.com/video/848426/apple-wireless-keyboard-unboxing-and-review/ http://revver.com/watch/848426 Apple Wireless Keyboard Unboxing and Review The unboxing and my first thoughts of my new Apple wireless Keyboard. The unboxing and my first thoughts of my new Apple wireless Keyboard. Jaketvee Jaketvee apple best first keyboard new review stylish thoughts unboxing wireless nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mac vs PC: Boot Time Comparison Wed, 16 Apr 2008 15:28:39 -0800

Author: Jaketvee
Added: Wed, 16 Apr 2008 15:28:39 -0800
Duration: 543

I compared the boot times of three computers. Two running Windows XP SP2 and the other, a Mac mini, running Mac OS X 10.5.2 Leopard.

]]> bootcomparisonemachineshpmacminiospavilionpctimewindowsx http://revver.com/video/821559/mac-vs-pc-boot-time-comparison/ http://revver.com/watch/821559 Mac vs PC: Boot Time Comparison I compared the boot times of three computers. Two running Windows XP SP2 and the other, a Mac mini, running Mac OS X 10.5.2 Leopard. I compared the boot times of three computers. Two running Windows XP SP2 and the other, a Mac mini, running Mac OS X 10.5.2 Leopard. Jaketvee Jaketvee boot comparison emachines hp mac mini os pavilion pc time windows x nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ What is Twitter? Mon, 14 Apr 2008 13:23:06 -0800

Author: Jaketvee
Added: Mon, 14 Apr 2008 13:23:06 -0800
Duration: 208

Twitter is an amazing website that allows you to keep up-to-date with what the world is doing! http://twitter.com http://twitter.com/jaketvee http://jak-e.com http://live.jak-e.com

]]> blogfreeimistwitterwhat http://revver.com/video/816268/what-is-twitter/ http://revver.com/watch/816268 What is Twitter? Twitter is an amazing website that allows you to keep up-to-date with what the world is doing! http://twitter.com http://twitter.com/jaketvee http://jak-e.com http://live.jak-e.com Twitter is an amazing website that allows you to keep up-to-date with what the world is doing! http://twitter.com http://twitter.com/jaketvee http://jak-e.com http://live.jak-e.com Jaketvee Jaketvee blog free im is twitter what nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Magic Clock Sun, 13 Apr 2008 15:19:34 -0800

Author: Jaketvee
Added: Sun, 13 Apr 2008 15:19:34 -0800
Duration: 158

A Cool Clock that can set the time all by itself!

]]> byclockcontrolledcoolgadgetitslefjak-emagicradiosettechtime http://revver.com/video/814171/magic-clock/ http://revver.com/watch/814171 Magic Clock A Cool Clock that can set the time all by itself! A Cool Clock that can set the time all by itself! Jaketvee Jaketvee by clock controlled cool gadget itslef jak-e magic radio set tech time nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Leopard - First Boot Mon, 07 Apr 2008 11:52:32 -0800

Author: Jaketvee
Added: Mon, 07 Apr 2008 11:52:32 -0800
Duration: 466

This was the first time I ever used a Mac so I was pretty excited to boot leopard for the first time.

]]> 10.5applebootfirstleopardmacminiosx http://revver.com/video/796373/leopard-first-boot/ http://revver.com/watch/796373 Leopard - First Boot This was the first time I ever used a Mac so I was pretty excited to boot leopard for the first time. This was the first time I ever used a Mac so I was pretty excited to boot leopard for the first time. Jaketvee Jaketvee 10.5 apple boot first leopard mac mini os x nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mac mini Unboxing Wed, 02 Apr 2008 13:16:23 -0800

Author: Jaketvee
Added: Wed, 02 Apr 2008 13:16:23 -0800
Duration: 588

I finally got my Mac mini, after considering getting one for one whole year. It was really easy to set up and the Mac mini itself is extremely small!

]]> applecomputermacmacintoshminismallunboxing http://revver.com/video/785677/mac-mini-unboxing/ http://revver.com/watch/785677 Mac mini Unboxing I finally got my Mac mini, after considering getting one for one whole year. It was really easy to set up and the Mac mini itself is extremely small! I finally got my Mac mini, after considering getting one for one whole year. It was really easy to set up and the Mac mini itself is extremely small! Jaketvee Jaketvee apple computer mac macintosh mini small unboxing nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Review: Microsoft Wireless Laser Mouse and Keyboard 5000 Sat, 29 Mar 2008 08:16:17 -0800

Author: Jaketvee
Added: Sat, 29 Mar 2008 08:16:17 -0800
Duration: 498

I Love my mouse and keyboard - I like them so much I clicked record and started talking about them...

]]> 5000keyboardlasermicrosoftmousereviewwirless http://revver.com/video/776139/review-microsoft-wireless-laser-mouse-and-keyboard-5000/ http://revver.com/watch/776139 Review: Microsoft Wireless Laser Mouse and Keyboard 5000 I Love my mouse and keyboard - I like them so much I clicked record and started talking about them... I Love my mouse and keyboard - I like them so much I clicked record and started talking about them... Jaketvee Jaketvee 5000 keyboard laser microsoft mouse review wirless nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Get a Free Domain Name Sat, 08 Mar 2008 07:46:16 -0800

Author: Jaketvee
Added: Sat, 08 Mar 2008 07:46:16 -0800
Duration: 435

A Domain name is the thing you type into an address bar, for example jak-e.com. To get one normally costs a certain amount of money every year, however I will show you how to legally get a free one that will point to any website you already have!

]]> addressdomainfreejak-ejakenameurlwebsite http://revver.com/video/729452/get-a-free-domain-name/ http://revver.com/watch/729452 Get a Free Domain Name A Domain name is the thing you type into an address bar, for example jak-e.com. To get one normally costs a certain amount of money every year, however I will show you how to legally get a free one that will point to any website you already have! A Domain name is the thing you type into an address bar, for example jak-e.com. To get one normally costs a certain amount of money every year, however I will show you how to legally get a free one that will point to any website you already have! Jaketvee Jaketvee address domain free jak-e jake name url website nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ AntiVirus Software - PC Security Sun, 02 Mar 2008 05:16:16 -0800

Author: Jaketvee
Added: Sun, 02 Mar 2008 05:16:16 -0800
Duration: 458

Every Windows user needs security - i.e. AntiVirus & AntiSpyware software and a Firewall. I talk about a few free programs that will keep your computer safe.

]]> antivirusfreesecuritysoftware http://revver.com/video/714854/antivirus-software-pc-security/ http://revver.com/watch/714854 AntiVirus Software - PC Security Every Windows user needs security - i.e. AntiVirus & AntiSpyware software and a Firewall. I talk about a few free programs that will keep your computer safe. Every Windows user needs security - i.e. AntiVirus & AntiSpyware software and a Firewall. I talk about a few free programs that will keep your computer safe. Jaketvee Jaketvee antivirus free security software nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Upload Videos to Multiple Sites at Once Wed, 20 Feb 2008 02:46:22 -0800

Author: Jaketvee
Added: Wed, 20 Feb 2008 02:46:22 -0800
Duration: 345

TubeMogul is a site that allows you to upload your vdeos to 12 sites in just one click including YouTube, Revver and Google Video!

]]> atclickinloadslotsmultipleonceonesitestouploadvideos http://revver.com/video/692110/upload-videos-to-multiple-sites-at-once/ http://revver.com/watch/692110 Upload Videos to Multiple Sites at Once TubeMogul is a site that allows you to upload your vdeos to 12 sites in just one click including YouTube, Revver and Google Video! TubeMogul is a site that allows you to upload your vdeos to 12 sites in just one click including YouTube, Revver and Google Video! Jaketvee Jaketvee at click in loads lots multiple once one sites to upload videos nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ How to Install Fonts from the internet Tue, 12 Feb 2008 15:16:22 -0800

Author: Jaketvee
Added: Tue, 12 Feb 2008 15:16:22 -0800
Duration: 313

How to download, extract and install fonts from the internet. All for free!

]]> archivedownloadfontsforfreeinstallinternet http://revver.com/video/677002/how-to-install-fonts-from-the-internet/ http://revver.com/watch/677002 How to Install Fonts from the internet How to download, extract and install fonts from the internet. All for free! How to download, extract and install fonts from the internet. All for free! Jaketvee Jaketvee archive download fonts for free install internet nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ How to Make Folders and Shortcuts Mon, 11 Feb 2008 14:46:25 -0800

Author: Jaketvee
Added: Mon, 11 Feb 2008 14:46:25 -0800
Duration: 333

Learn how to create folders and shortcuts on your computer!

]]> 2000createexplorerfoldershowmakeshortcutstovistawindowsxo http://revver.com/video/671336/how-to-make-folders-and-shortcuts/ http://revver.com/watch/671336 How to Make Folders and Shortcuts Learn how to create folders and shortcuts on your computer! Learn how to create folders and shortcuts on your computer! Jaketvee Jaketvee 2000 create explorer folders how make shortcuts to vista windows xo nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ How to use an Eyetoy as a Webcam Mon, 11 Feb 2008 04:16:19 -0800

Author: Jaketvee
Added: Mon, 11 Feb 2008 04:16:19 -0800
Duration: 446

Ever wanted a good quality webcam? Did you know that you can use an eyetoy as a webcam? In this video I go through the steps required to get your EyeToy up and running to be used as a webcam on your computer. It'll work with Instant Messaging applications!

]]> ascheapeyetoygoodiminstantlivemessagemoviemyqualityrecordstreamusevideowebcamyour http://revver.com/video/670188/how-to-use-an-eyetoy-as-a-webcam/ http://revver.com/watch/670188 How to use an Eyetoy as a Webcam Ever wanted a good quality webcam? Did you know that you can use an eyetoy as a webcam? In this video I go through the steps required to get your EyeToy up and running to be used as a webcam on your computer. It'll work with Instant Messaging applications! Ever wanted a good quality webcam? Did you know that you can use an eyetoy as a webcam? In this video I go through the steps required to get your EyeToy up and running to be used as a webcam on your computer. It'll work with Instant Messaging applications! Jaketvee Jaketvee as cheap eyetoy good im instant live message movie my quality record stream use video webcam your nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Linux Part 1/2 - Running DSL from a Live CD Sun, 10 Feb 2008 11:46:18 -0800

Author: Jaketvee
Added: Sun, 10 Feb 2008 11:46:18 -0800
Duration: 584

In this video I explain how to use a Live CD. This allows you to run linux on your computer without installing it!

]]> beforecddistrodslinstalllinuxlivetry http://revver.com/video/669089/linux-part-12-running-dsl-from-a-live-cd/ http://revver.com/watch/669089 Linux Part 1/2 - Running DSL from a Live CD In this video I explain how to use a Live CD. This allows you to run linux on your computer without installing it! In this video I explain how to use a Live CD. This allows you to run linux on your computer without installing it! Jaketvee Jaketvee before cd distro dsl install linux live try nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ SuperWebcam - Free alternative to WebcamMax Sat, 09 Feb 2008 13:16:20 -0800

Author: Jaketvee
Added: Sat, 09 Feb 2008 13:16:20 -0800
Duration: 481

Many online broadcasters or video bloggers use software to add effects to their video. For example a logo or topic. SuperWebcam is free software for Windows that allows you do do just that!

]]> effectsfreeonlinestreamingsuperwebcamvdeowebcammax http://revver.com/video/667652/superwebcam-free-alternative-to-webcammax/ http://revver.com/watch/667652 SuperWebcam - Free alternative to WebcamMax Many online broadcasters or video bloggers use software to add effects to their video. For example a logo or topic. SuperWebcam is free software for Windows that allows you do do just that! Many online broadcasters or video bloggers use software to add effects to their video. For example a logo or topic. SuperWebcam is free software for Windows that allows you do do just that! Jaketvee Jaketvee effects free online streaming superwebcam vdeo webcammax nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ CSS Style Sheets and HTML Sat, 12 Jan 2008 15:06:35 -0800

Author: Jaketvee
Added: Sat, 12 Jan 2008 15:06:35 -0800
Duration: 585

In the first HTML video I only explained basic tags so in this video I attempt to outline some basic CSS Style sheet syntax. Cascading Style Sheets are a great way to customize and personalize a web page or even a whole website. One Style Sheet can be used on all pages so they all look and feel like they are part of the same one!

]]> cascadingcsshtmlhyperinternetlanguagemakemarkupownsheetsstyletextwebwebpagewebsitewideworld http://revver.com/video/613249/css-style-sheets-and-html/ http://revver.com/watch/613249 CSS Style Sheets and HTML In the first HTML video I only explained basic tags so in this video I attempt to outline some basic CSS Style sheet syntax. Cascading Style Sheets are a great way to customize and personalize a web page or even a whole website. One Style Sheet can be used on all pages so they all look and feel like they are part of the same one! In the first HTML video I only explained basic tags so in this video I attempt to outline some basic CSS Style sheet syntax. Cascading Style Sheets are a great way to customize and personalize a web page or even a whole website. One Style Sheet can be used on all pages so they all look and feel like they are part of the same one! Created by jak-e Created by jak-e cascading css html hyper internet language make markup own sheets style text web webpage website wide world nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Good Hosting Service Mon, 07 Jan 2008 10:37:35 -0800

Author: Jaketvee
Added: Mon, 07 Jan 2008 10:37:35 -0800
Duration: 215

Nearly every internet user has some online storage space or has there own server. Most people have an email address with an inbox and lots more have websites. I was asked by a viewer if I knew of any good hosting services. Watch the video to learn more...

]]> cheapcontroldomainemailextentionsfrontpageftpgodaddygoodhostinginboxnameonlinepanelphpscriptserveserversstoragewebsite http://revver.com/video/604761/good-hosting-service/ http://revver.com/watch/604761 Good Hosting Service Nearly every internet user has some online storage space or has there own server. Most people have an email address with an inbox and lots more have websites. I was asked by a viewer if I knew of any good hosting services. Watch the video to learn more... Nearly every internet user has some online storage space or has there own server. Most people have an email address with an inbox and lots more have websites. I was asked by a viewer if I knew of any good hosting services. Watch the video to learn more... Hosted by Jake Wright Hosted by Jake Wright cheap control domain email extentions frontpage ftp godaddy good hosting inbox name online panel php script serve servers storage website nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Subscribe to jak-eTvee for all of your tech needs! Sat, 05 Jan 2008 06:28:30 -0800

Author: Jaketvee
Added: Sat, 05 Jan 2008 06:28:30 -0800
Duration: 44

http://jak-e.com - jak-eTvee is a show about tech, computers and lots of other things in between so subscribe today by clicking the orange button!

]]> computershelpshowstreamsubscribetechtipstricks http://revver.com/video/600896/subscribe-to-jak-etvee-for-all-of-your-tech-needs/ http://revver.com/watch/600896 Subscribe to jak-eTvee for all of your tech needs! http://jak-e.com - jak-eTvee is a show about tech, computers and lots of other things in between so subscribe today by clicking the orange button! http://jak-e.com - jak-eTvee is a show about tech, computers and lots of other things in between so subscribe today by clicking the orange button! Created by Jake Wright Created by Jake Wright computers help show stream subscribe tech tips tricks nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ First Snow of 2008 Thu, 03 Jan 2008 07:30:24 -0800

Author: Jaketvee
Added: Thu, 03 Jan 2008 07:30:24 -0800
Duration: 372

It started snowing on the 3rd of January 08 and I couldn't miss the opportunity to record the first snow of 2008. The song is the theme of Windows XP. I have a video on how to find it. All of my videos are on http://jak-e.com and my blog which can be accessed from the same place! Please Comment and Subscribe to jak-eTvee :D

]]> 2008beautifulfirstgardenjakemusicpicturesnowthemewhitewindowswrightxp http://revver.com/video/597299/first-snow-of-2008/ http://revver.com/watch/597299 First Snow of 2008 It started snowing on the 3rd of January 08 and I couldn't miss the opportunity to record the first snow of 2008. The song is the theme of Windows XP. I have a video on how to find it. All of my videos are on http://jak-e.com and my blog which can be accessed from the same place! Please Comment and Subscribe to jak-eTvee :D It started snowing on the 3rd of January 08 and I couldn't miss the opportunity to record the first snow of 2008. The song is the theme of Windows XP. I have a video on how to find it. All of my videos are on http://jak-e.com and my blog which can be accessed from the same place! Please Comment and Subscribe to jak-eTvee :D Created by Jake Wright Created by Jake Wright 2008 beautiful first garden jake music picture snow theme white windows wright xp nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Make a Video Game for free Mon, 24 Dec 2007 13:48:16 -0800

Author: Jaketvee
Added: Mon, 24 Dec 2007 13:48:16 -0800
Duration: 455

In the first episode of jak-eTvee, uploaded to blip.tv, I will explain how to make your own Video game, using Game Maker 7. The software is free to download from http://yoyogames.com. Making a video game is easy and more fun than just playing one (not to mention it's much cheaper)!

]]> cheapcomputercreatefreegamejak-etveejakemakeowntvvideowrightyour http://revver.com/video/583931/make-a-video-game-for-free/ http://revver.com/watch/583931 Make a Video Game for free In the first episode of jak-eTvee, uploaded to blip.tv, I will explain how to make your own Video game, using Game Maker 7. The software is free to download from http://yoyogames.com. Making a video game is easy and more fun than just playing one (not to mention it's much cheaper)! In the first episode of jak-eTvee, uploaded to blip.tv, I will explain how to make your own Video game, using Game Maker 7. The software is free to download from http://yoyogames.com. Making a video game is easy and more fun than just playing one (not to mention it's much cheaper)! Copyright (C) Jake Wright 2007. All Rights Reserved. Copyright (C) Jake Wright 2007. All Rights Reserved. cheap computer create free game jak-etvee jake make own tv video wright your nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Unblock Command Prompt Sun, 23 Dec 2007 12:18:19 -0800

Author: Jaketvee
Added: Sun, 23 Dec 2007 12:18:19 -0800
Duration: 60

http://jak-e.blogspot.com This video explains how to unblock command prompt. It should work in schools!

]]> commandcomputershackjak-ejakepromptschoolstvtveeunblockwright http://revver.com/video/582409/unblock-command-prompt/ http://revver.com/watch/582409 Unblock Command Prompt http://jak-e.blogspot.com This video explains how to unblock command prompt. It should work in schools! http://jak-e.blogspot.com This video explains how to unblock command prompt. It should work in schools! Jaketvee Jaketvee command computers hack jak-e jake prompt schools tv tvee unblock wright nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Windows XP Hidden Theme Music and Sounds Sun, 23 Dec 2007 10:18:15 -0800

Author: Jaketvee
Added: Sun, 23 Dec 2007 10:18:15 -0800
Duration: 387

http://jak-e.blogspot.com In this video from jak-eTvee, I will explain how to get the XP Music you heard when you started Windows for the first time and then show all of the Windows XP Sounds that I could find on my Hard Drive!

]]> computerseffectsfirsthard drivehiddenjak-ejakemusicsetupsoundsstartedtechnologythemetimetipstrickstvtveewindowswrightxp http://revver.com/video/582402/windows-xp-hidden-theme-music-and-sounds/ http://revver.com/watch/582402 Windows XP Hidden Theme Music and Sounds http://jak-e.blogspot.com In this video from jak-eTvee, I will explain how to get the XP Music you heard when you started Windows for the first time and then show all of the Windows XP Sounds that I could find on my Hard Drive! http://jak-e.blogspot.com In this video from jak-eTvee, I will explain how to get the XP Music you heard when you started Windows for the first time and then show all of the Windows XP Sounds that I could find on my Hard Drive! Jaketvee Jaketvee computers effects first hard drive hidden jak-e jake music setup sounds started technology theme time tips tricks tv tvee windows wright xp nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Jean Michel Jarre - OXYGENE - played by me! Sun, 23 Dec 2007 08:48:15 -0800

Author: Jaketvee
Added: Sun, 23 Dec 2007 08:48:15 -0800
Duration: 147

This video is another one of me playing m keyboard. This time I am playing Oxygene by Jean Michel Jarre. Please watch and comment on it. Remember, I have lots of other videos on my blog (the URL is above). The Intro has been speeded up but, as much as you might think so, the actual video of me playing has not!

]]> jak-ejakejarrejeankeyboardmemicheloxygenepianoplayedtvtveewright http://revver.com/video/582324/jean-michel-jarre-oxygene-played-by-me/ http://revver.com/watch/582324 Jean Michel Jarre - OXYGENE - played by me! This video is another one of me playing m keyboard. This time I am playing Oxygene by Jean Michel Jarre. Please watch and comment on it. Remember, I have lots of other videos on my blog (the URL is above). The Intro has been speeded up but, as much as you might think so, the actual video of me playing has not! This video is another one of me playing m keyboard. This time I am playing Oxygene by Jean Michel Jarre. Please watch and comment on it. Remember, I have lots of other videos on my blog (the URL is above). The Intro has been speeded up but, as much as you might think so, the actual video of me playing has not! Jaketvee Jaketvee jak-e jake jarre jean keyboard me michel oxygene piano played tv tvee wright nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ The Heat is on in Saigon Sun, 23 Dec 2007 08:18:14 -0800

Author: Jaketvee
Added: Sun, 23 Dec 2007 08:18:14 -0800
Duration: 174

This is a song called "The Heat is on in Saigon" and is from a musical called "Miss Saigon". This video shows me playing it on my keyboard! I know it has nothing to do with computers but some people like to watch these things, and the more viewers, the better!

]]> heatjak-ejakekeyboardmissmusicmusicalpianosaigontvtveewright http://revver.com/video/582263/the-heat-is-on-in-saigon/ http://revver.com/watch/582263 The Heat is on in Saigon This is a song called "The Heat is on in Saigon" and is from a musical called "Miss Saigon". This video shows me playing it on my keyboard! I know it has nothing to do with computers but some people like to watch these things, and the more viewers, the better! This is a song called "The Heat is on in Saigon" and is from a musical called "Miss Saigon". This video shows me playing it on my keyboard! I know it has nothing to do with computers but some people like to watch these things, and the more viewers, the better! Jaketvee Jaketvee heat jak-e jake keyboard miss music musical piano saigon tv tvee wright nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Learn HTML in 10 Minutes Sun, 23 Dec 2007 07:56:28 -0800

Author: Jaketvee
Added: Sun, 23 Dec 2007 07:56:28 -0800
Duration: 596

http://jak-e.blogspot.com This is my 10 minute tutorial on writing HTML. I explain the basic structure of an HTML webpage and introduce some tags. Another great tutorial from jaketvee!

]]> 10dreamweaverfrontpagehtmlhyperinternetjak-ejakelanguagelearnmarkupminutesnotepadprogrammingtexttvtveewebwebpagewebsitewideworldwright http://revver.com/video/582233/learn-html-in-10-minutes/ http://revver.com/watch/582233 Learn HTML in 10 Minutes http://jak-e.blogspot.com This is my 10 minute tutorial on writing HTML. I explain the basic structure of an HTML webpage and introduce some tags. Another great tutorial from jaketvee! http://jak-e.blogspot.com This is my 10 minute tutorial on writing HTML. I explain the basic structure of an HTML webpage and introduce some tags. Another great tutorial from jaketvee! Jaketvee Jaketvee 10 dreamweaver frontpage html hyper internet jak-e jake language learn markup minutes notepad programming text tv tvee web webpage website wide world wright nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Harry and Pat Sun, 23 Dec 2007 07:52:21 -0800

Author: Jaketvee
Added: Sun, 23 Dec 2007 07:52:21 -0800
Duration: 121

http://jak-e.blogspot.com This is a short, funny cartoon from jak-eTvee! I made it about three years ago and I still find it hilarious.

]]> animationcartoonfunnyharryjak-ejakepatshorttvtveewright http://revver.com/video/582227/harry-and-pat/ http://revver.com/watch/582227 Harry and Pat http://jak-e.blogspot.com This is a short, funny cartoon from jak-eTvee! I made it about three years ago and I still find it hilarious. http://jak-e.blogspot.com This is a short, funny cartoon from jak-eTvee! I made it about three years ago and I still find it hilarious. Jaketvee Jaketvee animation cartoon funny harry jak-e jake pat short tv tvee wright nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Classic Logon in Windows XP Sun, 23 Dec 2007 07:21:58 -0800

Author: Jaketvee
Added: Sun, 23 Dec 2007 07:21:58 -0800
Duration: 84

http://jak-e.blogspot.com Disable the 'Welcome Screen' and force all users to press Ctrl+Alt+Del to logon. Doing this increases security on your computer especially if you are on a network. Following the simple steps in this Tutorial swaps the 'Welcome Screen' for the logon prompt like in Windows 2000 and users must type a username and password.

]]> 2000altcomputerscontrolctrldeldeletedisablejak-elogonscreentechnologytveewelomewindowsxp http://revver.com/video/582207/classic-logon-in-windows-xp/ http://revver.com/watch/582207 Classic Logon in Windows XP http://jak-e.blogspot.com Disable the 'Welcome Screen' and force all users to press Ctrl+Alt+Del to logon. Doing this increases security on your computer especially if you are on a network. Following the simple steps in this Tutorial swaps the 'Welcome Screen' for the logon prompt like in Windows 2000 and users must type a username and password. http://jak-e.blogspot.com Disable the 'Welcome Screen' and force all users to press Ctrl+Alt+Del to logon. Doing this increases security on your computer especially if you are on a network. Following the simple steps in this Tutorial swaps the 'Welcome Screen' for the logon prompt like in Windows 2000 and users must type a username and password. Jaketvee Jaketvee 2000 alt computers control ctrl del delete disable jak-e logon screen technology tvee welome windows xp nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Access the Clipboard Viewer in Windows XP Sun, 23 Dec 2007 07:21:58 -0800

Author: Jaketvee
Added: Sun, 23 Dec 2007 07:21:58 -0800
Duration: 119

http://jak-e.blogspot.com A short video from jak-eTvee. I will explain how to access the built in clipboard viewer in Windows XP! It was available in Windows 95 but it has hidden itself more and more over time so now I will teach you how to wake it up and get it out of bed!

]]> 200095accessclipboardcomputersjak-ejaketechnologytipstrickstvtveeviewervistawindowswrightxp http://revver.com/video/582217/access-the-clipboard-viewer-in-windows-xp/ http://revver.com/watch/582217 Access the Clipboard Viewer in Windows XP http://jak-e.blogspot.com A short video from jak-eTvee. I will explain how to access the built in clipboard viewer in Windows XP! It was available in Windows 95 but it has hidden itself more and more over time so now I will teach you how to wake it up and get it out of bed! http://jak-e.blogspot.com A short video from jak-eTvee. I will explain how to access the built in clipboard viewer in Windows XP! It was available in Windows 95 but it has hidden itself more and more over time so now I will teach you how to wake it up and get it out of bed! Jaketvee Jaketvee 2000 95 access clipboard computers jak-e jake technology tips tricks tv tvee viewer vista windows wright xp nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/