Videos by Meshmonster Videos by Meshmonster http://revver.com/u/Meshmonster/ http://revver.com webmaster@revver.com Monica Seles and USTA - Tennis Night in America Tue, 03 Mar 2009 19:52:43 -0800

Author: Meshmonster
Added: Tue, 03 Mar 2009 19:52:43 -0800
Duration: 155

Monica Seles is a true phenom in the game of tennis. At 16 she won her first French Open, the youngest women to ever win that title. Monica is working with the United States Tennis Association to get kids involved in the game by promoting Tennis Night in America.

]]> kidsmonica selestennistennis night in americausta http://revver.com/video/1517400/monica-seles-and-usta-tennis-night-in-america/ http://revver.com/watch/1517400 Monica Seles and USTA - Tennis Night in America Monica Seles is a true phenom in the game of tennis. At 16 she won her first French Open, the youngest women to ever win that title. Monica is working with the United States Tennis Association to get kids involved in the game by promoting Tennis Night in America. Monica Seles is a true phenom in the game of tennis. At 16 she won her first French Open, the youngest women to ever win that title. Monica is working with the United States Tennis Association to get kids involved in the game by promoting Tennis Night in America. Meshmonster Meshmonster kids monica seles tennis tennis night in america usta nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Supermarket Guru Phil Lampert - Grocery Shopping Tips Fri, 27 Feb 2009 14:31:47 -0800

Author: Meshmonster
Added: Fri, 27 Feb 2009 14:31:47 -0800
Duration: 206

A trip to the grocery store is so routine, we do it without giving it much thought. The grocery industry studies our shopping habits intensely. They’re telling us what they’ve found out in the latest consumer panel survey. Supermarket Guru Phil Lempert says there was at least one big surprise.

]]> groceriesphil lampertshoppingsupermarket http://revver.com/video/1510452/supermarket-guru-phil-lampert-grocery-shopping-tips/ http://revver.com/watch/1510452 Supermarket Guru Phil Lampert - Grocery Shopping Tips A trip to the grocery store is so routine, we do it without giving it much thought. The grocery industry studies our shopping habits intensely. They’re telling us what they’ve found out in the latest consumer panel survey. Supermarket Guru Phil Lempert says there was at least one big surprise. A trip to the grocery store is so routine, we do it without giving it much thought. The grocery industry studies our shopping habits intensely. They’re telling us what they’ve found out in the latest consumer panel survey. Supermarket Guru Phil Lempert says there was at least one big surprise. Meshmonster Meshmonster groceries phil lampert shopping supermarket nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ American Idol Brooke White - Teenagers, Get That Flu Shot Fri, 27 Feb 2009 14:31:47 -0800

Author: Meshmonster
Added: Fri, 27 Feb 2009 14:31:47 -0800
Duration: 137

The new CDC recommendations for protecting teenagers from influenza. For the 1st time ever, the Centers for Disease Control has recommended that all teenagers get their flu. This is an important time, if you haven’t gotten your flu shot yet, to get it so that you don’t have to miss, as Brooke White says, the important moments of your life.

]]> american idolbrooke whiteflushotteenagers http://revver.com/video/1510517/american-idol-brooke-white-teenagers-get-that-flu-shot/ http://revver.com/watch/1510517 American Idol Brooke White - Teenagers, Get That Flu Shot The new CDC recommendations for protecting teenagers from influenza. For the 1st time ever, the Centers for Disease Control has recommended that all teenagers get their flu. This is an important time, if you haven’t gotten your flu shot yet, to get it so that you don’t have to miss, as Brooke White says, the important moments of your life. The new CDC recommendations for protecting teenagers from influenza. For the 1st time ever, the Centers for Disease Control has recommended that all teenagers get their flu. This is an important time, if you haven’t gotten your flu shot yet, to get it so that you don’t have to miss, as Brooke White says, the important moments of your life. Meshmonster Meshmonster american idol brooke white flu shot teenagers nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Design Expert Kelly Edwards Spring Cleaning Tips Fri, 27 Feb 2009 13:52:46 -0800

Author: Meshmonster
Added: Fri, 27 Feb 2009 13:52:46 -0800
Duration: 411

KELLY EDWARDS HAS BEEN DEEMED BY MANY AS THE “MACGYVER” OF DESIGN FOR HER ABILITY TO TURN EVERYDAY HOUSEHOLD ITEMS INTO EXTRAORDINARY PIECES. KELLY HAS TIPS TO HELP US JUMP-START SPRING CLEANING BY REMOVING CLUTTER AND PICKING OUT PIECES THAT CAN DO DOUBLE DUTY IN YOUR HOME.

]]> clutterdesignhouseholdspring cleaningtips http://revver.com/video/1510405/design-expert-kelly-edwards-spring-cleaning-tips/ http://revver.com/watch/1510405 Design Expert Kelly Edwards Spring Cleaning Tips KELLY EDWARDS HAS BEEN DEEMED BY MANY AS THE “MACGYVER” OF DESIGN FOR HER ABILITY TO TURN EVERYDAY HOUSEHOLD ITEMS INTO EXTRAORDINARY PIECES. KELLY HAS TIPS TO HELP US JUMP-START SPRING CLEANING BY REMOVING CLUTTER AND PICKING OUT PIECES THAT CAN DO DOUBLE DUTY IN YOUR HOME. KELLY EDWARDS HAS BEEN DEEMED BY MANY AS THE “MACGYVER” OF DESIGN FOR HER ABILITY TO TURN EVERYDAY HOUSEHOLD ITEMS INTO EXTRAORDINARY PIECES. KELLY HAS TIPS TO HELP US JUMP-START SPRING CLEANING BY REMOVING CLUTTER AND PICKING OUT PIECES THAT CAN DO DOUBLE DUTY IN YOUR HOME. Meshmonster Meshmonster clutter design household spring cleaning tips nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Quit Smoking - the NicoDerm Patch and Commit Lozenges Fri, 13 Feb 2009 19:52:43 -0800

Author: Meshmonster
Added: Fri, 13 Feb 2009 19:52:43 -0800
Duration: 85

WomenHeart and Colgate are raising awareness about heart disease, the number 1 killer and number 1 disabler of people in the U.S. by launching the Heart Promises campaign. Studies show that there is an association between gum disease and heart health.

]]> diseasehealthheartwomenheart http://revver.com/video/1491567/quit-smoking-the-nicoderm-patch-and-commit-lozenges/ http://revver.com/watch/1491567 Quit Smoking - the NicoDerm Patch and Commit Lozenges WomenHeart and Colgate are raising awareness about heart disease, the number 1 killer and number 1 disabler of people in the U.S. by launching the Heart Promises campaign. Studies show that there is an association between gum disease and heart health. WomenHeart and Colgate are raising awareness about heart disease, the number 1 killer and number 1 disabler of people in the U.S. by launching the Heart Promises campaign. Studies show that there is an association between gum disease and heart health. Meshmonster Meshmonster disease health heart womenheart nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Brothers Dave and Joe Herbert win Doritos Crash the Super Bowl Mon, 09 Feb 2009 19:31:47 -0800

Author: Meshmonster
Added: Mon, 09 Feb 2009 19:31:47 -0800
Duration: 101

Brothers Dave and Joe Herbert take home this year’s top prize in Doritos ‘Crash the Super Bowl’ contest. The amateur film-makers won twenty-five thousand dollars, sky box seats at Super Bowl forty-three and they also received $1,000,000 for topping USA Today’s Super Bowl Ad Meter.

]]> commercialscontestdoritossuper bowlwinners http://revver.com/video/1483329/brothers-dave-and-joe-herbert-win-doritos-crash-the-super-bowl/ http://revver.com/watch/1483329 Brothers Dave and Joe Herbert win Doritos Crash the Super Bowl Brothers Dave and Joe Herbert take home this year’s top prize in Doritos ‘Crash the Super Bowl’ contest. The amateur film-makers won twenty-five thousand dollars, sky box seats at Super Bowl forty-three and they also received $1,000,000 for topping USA Today’s Super Bowl Ad Meter. Brothers Dave and Joe Herbert take home this year’s top prize in Doritos ‘Crash the Super Bowl’ contest. The amateur film-makers won twenty-five thousand dollars, sky box seats at Super Bowl forty-three and they also received $1,000,000 for topping USA Today’s Super Bowl Ad Meter. Meshmonster Meshmonster commercials contest doritos super bowl winners nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Ovie Mughelli Shares Winning Football Party Recipes Thu, 05 Feb 2009 23:52:40 -0800

Author: Meshmonster
Added: Thu, 05 Feb 2009 23:52:40 -0800
Duration: 130

If you are planning to party while watching this year's big game, these winning recipes from Atlanta Falcons Ovie Mughelli are sure to make your football party a touchdown.

]]> entertainingfootballovie mughellipartyrecipes http://revver.com/video/1475926/ovie-mughelli-shares-winning-football-party-recipes/ http://revver.com/watch/1475926 Ovie Mughelli Shares Winning Football Party Recipes If you are planning to party while watching this year's big game, these winning recipes from Atlanta Falcons Ovie Mughelli are sure to make your football party a touchdown. If you are planning to party while watching this year's big game, these winning recipes from Atlanta Falcons Ovie Mughelli are sure to make your football party a touchdown. Meshmonster Meshmonster entertaining football ovie mughelli party recipes nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Thom Filicia - Inexpensive and Easy Decorating Tips Thu, 05 Feb 2009 13:31:51 -0800

Author: Meshmonster
Added: Thu, 05 Feb 2009 13:31:51 -0800
Duration: 158

Thom Filicia of the Style Network's "Dress My Nest" offers simple ways to freshen up your space. Thom is helping to promote Kimberly-Clark's Room-A-Day Give-Away sweepstakes.

]]> home decoratingremodelingstylethom filicia http://revver.com/video/1474343/thom-filicia-inexpensive-and-easy-decorating-tips/ http://revver.com/watch/1474343 Thom Filicia - Inexpensive and Easy Decorating Tips Thom Filicia of the Style Network's "Dress My Nest" offers simple ways to freshen up your space. Thom is helping to promote Kimberly-Clark's Room-A-Day Give-Away sweepstakes. Thom Filicia of the Style Network's "Dress My Nest" offers simple ways to freshen up your space. Thom is helping to promote Kimberly-Clark's Room-A-Day Give-Away sweepstakes. Meshmonster Meshmonster home decorating remodeling style thom filicia nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Two Minutes for the Planet Featuring Laura Turner Seydel - Episode 2 Wed, 04 Feb 2009 19:31:45 -0800

Author: Meshmonster
Added: Wed, 04 Feb 2009 19:31:45 -0800
Duration: 120

Laura provides useful tips on driving green; how to drive green, the importance of auto maintenance and tips on finding an environmentally friendly car.

]]> driving greenenvironmentfuel efficiencygas milage http://revver.com/video/1472787/two-minutes-for-the-planet-featuring-laura-turner-seydel-episode-2/ http://revver.com/watch/1472787 Two Minutes for the Planet Featuring Laura Turner Seydel - Episode 2 Laura provides useful tips on driving green; how to drive green, the importance of auto maintenance and tips on finding an environmentally friendly car. Laura provides useful tips on driving green; how to drive green, the importance of auto maintenance and tips on finding an environmentally friendly car. Meshmonster Meshmonster driving green environment fuel efficiency gas milage nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Jody DeVere - Changing Wiper Blades Important for Driving Safety Wed, 04 Feb 2009 17:16:40 -0800

Author: Meshmonster
Added: Wed, 04 Feb 2009 17:16:40 -0800
Duration: 172

Rain, snow and ice aren’t to be taken lightly when on the highways. With 90% of driving decisions based on clear vision, Jody DeVere has partnered with RainX to raise awareness about the most important and most vital safety feature; your wiper blades.

]]> carsdrivingjody deveresafeywinter driving http://revver.com/video/1471235/jody-devere-changing-wiper-blades-important-for-driving-safety/ http://revver.com/watch/1471235 Jody DeVere - Changing Wiper Blades Important for Driving Safety Rain, snow and ice aren’t to be taken lightly when on the highways. With 90% of driving decisions based on clear vision, Jody DeVere has partnered with RainX to raise awareness about the most important and most vital safety feature; your wiper blades. Rain, snow and ice aren’t to be taken lightly when on the highways. With 90% of driving decisions based on clear vision, Jody DeVere has partnered with RainX to raise awareness about the most important and most vital safety feature; your wiper blades. Meshmonster Meshmonster cars driving jody devere safey winter driving nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Contestants Try to Win Favor for Super Sunday Spot Wed, 04 Feb 2009 17:16:40 -0800

Author: Meshmonster
Added: Wed, 04 Feb 2009 17:16:40 -0800
Duration: 71

Five finalists of the Doritos Crash the superbowl contest will have a chance to win one million dollars and have their fan-based commercial air during the game. Get a sneak peak.

]]> commercialscontestdoritossuperbowl http://revver.com/video/1471103/contestants-try-to-win-favor-for-super-sunday-spot/ http://revver.com/watch/1471103 Contestants Try to Win Favor for Super Sunday Spot Five finalists of the Doritos Crash the superbowl contest will have a chance to win one million dollars and have their fan-based commercial air during the game. Get a sneak peak. Five finalists of the Doritos Crash the superbowl contest will have a chance to win one million dollars and have their fan-based commercial air during the game. Get a sneak peak. Meshmonster Meshmonster commercials contest doritos superbowl nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ AFLAC Bone Marrow Drive Fights Cancer & Other Diseases Wed, 14 Jan 2009 23:52:40 -0800

Author: Meshmonster
Added: Wed, 14 Jan 2009 23:52:40 -0800
Duration: 103

The need for people to donate bone marrow is urgent. 1000's search the registry daily looking for a match. Registering donors is painless, convenient and takes only minutes. AFLAC has taken the initiative to sponsor a bone marrow drive.

]]> aflacbone marrow drivecancerregister http://revver.com/video/1439358/aflac-bone-marrow-drive-fights-cancer-other-diseases/ http://revver.com/watch/1439358 AFLAC Bone Marrow Drive Fights Cancer & Other Diseases The need for people to donate bone marrow is urgent. 1000's search the registry daily looking for a match. Registering donors is painless, convenient and takes only minutes. AFLAC has taken the initiative to sponsor a bone marrow drive. The need for people to donate bone marrow is urgent. 1000's search the registry daily looking for a match. Registering donors is painless, convenient and takes only minutes. AFLAC has taken the initiative to sponsor a bone marrow drive. Meshmonster Meshmonster aflac bone marrow drive cancer register nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Olympian Jenny Finch - BOA's Hometown Hopefuls Center Mon, 12 Jan 2009 17:52:36 -0800

Author: Meshmonster
Added: Mon, 12 Jan 2009 17:52:36 -0800
Duration: 65

Gold Medalist Jennie Finch describes how Bank of America's Hometown Hopefuls Family Center will play host to the families and friends of more than 550 U.S. Olympic athletes during the 2008 Games in Beijing.

]]> beijingfinchjennieolympicsoftballsteamsteamunitedusa http://revver.com/video/1118723/olympian-jenny-finch-boas-hometown-hopefuls-center/ http://revver.com/watch/1118723 Olympian Jenny Finch - BOA's Hometown Hopefuls Center Gold Medalist Jennie Finch describes how Bank of America's Hometown Hopefuls Family Center will play host to the families and friends of more than 550 U.S. Olympic athletes during the 2008 Games in Beijing. Gold Medalist Jennie Finch describes how Bank of America's Hometown Hopefuls Family Center will play host to the families and friends of more than 550 U.S. Olympic athletes during the 2008 Games in Beijing. Meshmonster Meshmonster beijing finch jennie olympic softball steams team united usa nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Two Minutes for the Planet - Episode 1 Fri, 02 Jan 2009 14:31:43 -0800

Author: Meshmonster
Added: Fri, 02 Jan 2009 14:31:43 -0800
Duration: 121

Laura Turner Seydel, environmental activist, shares tips on how to live green by following three general rules: reduce, reuse and recycle.

]]> earthenvironmentgreenlaura turnerseydelthe planet http://revver.com/video/1415835/two-minutes-for-the-planet-episode-1/ http://revver.com/watch/1415835 Two Minutes for the Planet - Episode 1 Laura Turner Seydel, environmental activist, shares tips on how to live green by following three general rules: reduce, reuse and recycle. Laura Turner Seydel, environmental activist, shares tips on how to live green by following three general rules: reduce, reuse and recycle. Meshmonster Meshmonster earth environment green laura turner seydel the planet nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Biggest Loser Matt Hoover - Health Tips for the New Year Tue, 30 Dec 2008 17:49:36 -0800

Author: Meshmonster
Added: Tue, 30 Dec 2008 17:49:36 -0800
Duration: 56

Matt Hoover, Winner of "The Biggest Loser" season two shares tips on staying healthy. Featured products Britta, Immugo and Songbird. For more information, visit MoreTipsforYou.com.

]]> healthmatt hoovernew years resolutionsthe biggest loser http://revver.com/video/1411197/biggest-loser-matt-hoover-health-tips-for-the-new-year/ http://revver.com/watch/1411197 Biggest Loser Matt Hoover - Health Tips for the New Year Matt Hoover, Winner of "The Biggest Loser" season two shares tips on staying healthy. Featured products Britta, Immugo and Songbird. For more information, visit MoreTipsforYou.com. Matt Hoover, Winner of "The Biggest Loser" season two shares tips on staying healthy. Featured products Britta, Immugo and Songbird. For more information, visit MoreTipsforYou.com. Meshmonster Meshmonster health matt hoover new years resolutions the biggest loser nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ The Arthritis Foundation - Annual Jingle Bell Run-Walk for Arthritis Wed, 03 Dec 2008 19:31:47 -0800

Author: Meshmonster
Added: Wed, 03 Dec 2008 19:31:47 -0800
Duration: 384

Along with former NFL player, Carlester Crumpler, CEO of the Arthritis Foundation, Dr. John Klippel invites you to help raise money for the 46 million American adults and children suffering from this disease.

]]> arthritisarthritis foundationdr. john klippeljingle bell run http://revver.com/video/1356534/the-arthritis-foundation-annual-jingle-bell-run-walk-for-arthritis/ http://revver.com/watch/1356534 The Arthritis Foundation - Annual Jingle Bell Run-Walk for Arthritis Along with former NFL player, Carlester Crumpler, CEO of the Arthritis Foundation, Dr. John Klippel invites you to help raise money for the 46 million American adults and children suffering from this disease. Along with former NFL player, Carlester Crumpler, CEO of the Arthritis Foundation, Dr. John Klippel invites you to help raise money for the 46 million American adults and children suffering from this disease. Meshmonster Meshmonster arthritis arthritis foundation dr. john klippel jingle bell run nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Cyber Monday Shopping Tips Tue, 02 Dec 2008 14:52:35 -0800

Author: Meshmonster
Added: Tue, 02 Dec 2008 14:52:35 -0800
Duration: 491

Cyber Monday is the first Monday after Black Friday. The Internet is a welcome ally for those not willing to deal with the stress at the store and can be a great source of deals. Here are online shopping tips and cool web finds you may want to check out.

]]> christmas giftschristmas shoppingcyber monday http://revver.com/video/1354888/cyber-monday-shopping-tips/ http://revver.com/watch/1354888 Cyber Monday Shopping Tips Cyber Monday is the first Monday after Black Friday. The Internet is a welcome ally for those not willing to deal with the stress at the store and can be a great source of deals. Here are online shopping tips and cool web finds you may want to check out. Cyber Monday is the first Monday after Black Friday. The Internet is a welcome ally for those not willing to deal with the stress at the store and can be a great source of deals. Here are online shopping tips and cool web finds you may want to check out. Meshmonster Meshmonster christmas gifts christmas shopping cyber monday nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bobbie Thomas - Save Money Holiday Shopping Tue, 02 Dec 2008 14:52:35 -0800

Author: Meshmonster
Added: Tue, 02 Dec 2008 14:52:35 -0800
Duration: 148

Shopping expert Bobbie Thomas shows you how to save and stretch every dollar when shopping for the holidays and also discusses some of this year's hot gift items.

]]> christmas shoppinggiftsholidaysave money http://revver.com/video/1354428/bobbie-thomas-save-money-holiday-shopping/ http://revver.com/watch/1354428 Bobbie Thomas - Save Money Holiday Shopping Shopping expert Bobbie Thomas shows you how to save and stretch every dollar when shopping for the holidays and also discusses some of this year's hot gift items. Shopping expert Bobbie Thomas shows you how to save and stretch every dollar when shopping for the holidays and also discusses some of this year's hot gift items. Meshmonster Meshmonster christmas shopping gifts holiday save money nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Viginia Willis - Holiday Cooking Tips Mon, 17 Nov 2008 13:52:40 -0800

Author: Meshmonster
Added: Mon, 17 Nov 2008 13:52:40 -0800
Duration: 152

Virginia Willis former kitchen director for Martha Stewart, cooks her childhood Southern foods and gives you ideas to transform your holiday table into a feast of delicious hearty, healthful and soul-warming food.

]]> cookingholidayholidayssouthernvirginiawillis http://revver.com/video/1323811/viginia-willis-holiday-cooking-tips/ http://revver.com/watch/1323811 Viginia Willis - Holiday Cooking Tips Virginia Willis former kitchen director for Martha Stewart, cooks her childhood Southern foods and gives you ideas to transform your holiday table into a feast of delicious hearty, healthful and soul-warming food. Virginia Willis former kitchen director for Martha Stewart, cooks her childhood Southern foods and gives you ideas to transform your holiday table into a feast of delicious hearty, healthful and soul-warming food. Meshmonster Meshmonster cooking holiday holidays southern virginia willis nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Save a Landmark Program - Edgar Allan Poe Museum Fri, 14 Nov 2008 11:52:35 -0800

Author: Meshmonster
Added: Fri, 14 Nov 2008 11:52:35 -0800
Duration: 120

The Save a Landmark program spruces up the Edgar Allan Poe Museum in Richmond. The program has helped restore 41 landmarks so far. Learn more about it at www.hamptonlandmarks.com. Featuring Katarina Spears, museum director, and author Chris Epting.

]]> allanchrisedgareptinglandmarkmuseumpoesave http://revver.com/video/1314512/save-a-landmark-program-edgar-allan-poe-museum/ http://revver.com/watch/1314512 Save a Landmark Program - Edgar Allan Poe Museum The Save a Landmark program spruces up the Edgar Allan Poe Museum in Richmond. The program has helped restore 41 landmarks so far. Learn more about it at www.hamptonlandmarks.com. Featuring Katarina Spears, museum director, and author Chris Epting. The Save a Landmark program spruces up the Edgar Allan Poe Museum in Richmond. The program has helped restore 41 landmarks so far. Learn more about it at www.hamptonlandmarks.com. Featuring Katarina Spears, museum director, and author Chris Epting. Meshmonster Meshmonster allan chris edgar epting landmark museum poe save nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Gene Arnold - Immugo and Immune System Support Mon, 10 Nov 2008 14:33:54 -0800

Author: Meshmonster
Added: Mon, 10 Nov 2008 14:33:54 -0800
Duration: 55

For 20 years, Hollywood stars have turned to Gene Arnold, affectionately called “Vitamin Gene” for their wellness needs. Now Gene is promoting immune support with a combination of herbs and vitamins. Immugo. Immugo is available at Walmart and national pharmacy chain stores.

]]> arnoldgeneimmugoimmunesystemvitamins http://revver.com/video/1309592/gene-arnold-immugo-and-immune-system-support/ http://revver.com/watch/1309592 Gene Arnold - Immugo and Immune System Support For 20 years, Hollywood stars have turned to Gene Arnold, affectionately called “Vitamin Gene” for their wellness needs. Now Gene is promoting immune support with a combination of herbs and vitamins. Immugo. Immugo is available at Walmart and national pharmacy chain stores. For 20 years, Hollywood stars have turned to Gene Arnold, affectionately called “Vitamin Gene” for their wellness needs. Now Gene is promoting immune support with a combination of herbs and vitamins. Immugo. Immugo is available at Walmart and national pharmacy chain stores. Meshmonster Meshmonster arnold gene immugo immune system vitamins nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Amani Toomer - Home Depot Neighborhood MVP Mon, 10 Nov 2008 13:54:50 -0800

Author: Meshmonster
Added: Mon, 10 Nov 2008 13:54:50 -0800
Duration: 78

Amani Toomer New York Giants star receiver speaks about the Home Depot Neighborhood MVP program, a program that provides kids with safe places to play.

]]> amanidepotfootballgianthomekidsnewtoomeryork http://revver.com/video/1309509/amani-toomer-home-depot-neighborhood-mvp/ http://revver.com/watch/1309509 Amani Toomer - Home Depot Neighborhood MVP Amani Toomer New York Giants star receiver speaks about the Home Depot Neighborhood MVP program, a program that provides kids with safe places to play. Amani Toomer New York Giants star receiver speaks about the Home Depot Neighborhood MVP program, a program that provides kids with safe places to play. Meshmonster Meshmonster amani depot football giant home kids new toomer york nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Where Law Ends by Kevin Emmet Foley - Book Trailer Fri, 31 Oct 2008 14:52:34 -0800

Author: Meshmonster
Added: Fri, 31 Oct 2008 14:52:34 -0800
Duration: 60

Where Law Ends is an exciting new historical novel about the Montana Vigilantes by author Kevin Foley. What if the legend is a lie?

]]> booksmontanatrailersvigilanteswesterns http://revver.com/video/1291231/where-law-ends-by-kevin-emmet-foley-book-trailer/ http://revver.com/watch/1291231 Where Law Ends by Kevin Emmet Foley - Book Trailer Where Law Ends is an exciting new historical novel about the Montana Vigilantes by author Kevin Foley. What if the legend is a lie? Where Law Ends is an exciting new historical novel about the Montana Vigilantes by author Kevin Foley. What if the legend is a lie? Meshmonster Meshmonster books montana trailers vigilantes westerns nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mark Montano - Start Shopping Soon For Holiday Gifts Thu, 30 Oct 2008 13:55:30 -0800

Author: Meshmonster
Added: Thu, 30 Oct 2008 13:55:30 -0800
Duration: 68

Experts say that the sooner you start your holiday shopping, the better your chances of finding the hot holiday gifts of the season. Designer Mark Montano says WII and Elmo are back and new gadgets are always a win with any family member.

]]> gadgetsgiftsholidayshopping http://revver.com/video/1288756/mark-montano-start-shopping-soon-for-holiday-gifts/ http://revver.com/watch/1288756 Mark Montano - Start Shopping Soon For Holiday Gifts Experts say that the sooner you start your holiday shopping, the better your chances of finding the hot holiday gifts of the season. Designer Mark Montano says WII and Elmo are back and new gadgets are always a win with any family member. Experts say that the sooner you start your holiday shopping, the better your chances of finding the hot holiday gifts of the season. Designer Mark Montano says WII and Elmo are back and new gadgets are always a win with any family member. Meshmonster Meshmonster gadgets gifts holiday shopping nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Allegra - Relief for Children with Allergies Thu, 30 Oct 2008 13:55:30 -0800

Author: Meshmonster
Added: Thu, 30 Oct 2008 13:55:30 -0800
Duration: 90

Dr. Michael Blaiss, Clinical Professor of Pediatrics & Medicine at the University of Tennessee Health Sciences Center College of Medicine speaks about Allegra and other ways to control allergy symptoms.

]]> allegraallergieschildren http://revver.com/video/1288856/allegra-relief-for-children-with-allergies/ http://revver.com/watch/1288856 Allegra - Relief for Children with Allergies Dr. Michael Blaiss, Clinical Professor of Pediatrics & Medicine at the University of Tennessee Health Sciences Center College of Medicine speaks about Allegra and other ways to control allergy symptoms. Dr. Michael Blaiss, Clinical Professor of Pediatrics & Medicine at the University of Tennessee Health Sciences Center College of Medicine speaks about Allegra and other ways to control allergy symptoms. Meshmonster Meshmonster allegra allergies children nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Montgomery Gentry Takes Time from Tour to Support Troops Fri, 24 Oct 2008 16:35:49 -0800

Author: Meshmonster
Added: Fri, 24 Oct 2008 16:35:49 -0800
Duration: 133

Montgomery Gentry is taking time from the Biggest and Baddest Tour to launch a national campaign to generate support for U.S. troops. Get free postcards at VAULT retail displays nationwide. www.drinkvault.com

]]> baddestbiggestgentrymontgomerysupporttourtroopsvault http://revver.com/video/1277075/montgomery-gentry-takes-time-from-tour-to-support-troops/ http://revver.com/watch/1277075 Montgomery Gentry Takes Time from Tour to Support Troops Montgomery Gentry is taking time from the Biggest and Baddest Tour to launch a national campaign to generate support for U.S. troops. Get free postcards at VAULT retail displays nationwide. www.drinkvault.com Montgomery Gentry is taking time from the Biggest and Baddest Tour to launch a national campaign to generate support for U.S. troops. Get free postcards at VAULT retail displays nationwide. www.drinkvault.com Meshmonster Meshmonster baddest biggest gentry montgomery support tour troops vault nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Alberto Salazar Honorary Captain of Medtronic Marathon Fri, 17 Oct 2008 13:54:09 -0800

Author: Meshmonster
Added: Fri, 17 Oct 2008 13:54:09 -0800
Duration: 75

Alberto Salazar, world renowned marathon runner and winner of three consecutive New York City marathons, suffered a heart attack last year due to a genetic predisposition to heart disease. This year he returned to running, as honorary captain of the Medtronic Twin Cities Marathon, running with the help of implants from the Medtronic Foundation.

]]> alberto salazarheart diseasemarathonnew york city marathonrunning http://revver.com/video/1251574/alberto-salazar-honorary-captain-of-medtronic-marathon/ http://revver.com/watch/1251574 Alberto Salazar Honorary Captain of Medtronic Marathon Alberto Salazar, world renowned marathon runner and winner of three consecutive New York City marathons, suffered a heart attack last year due to a genetic predisposition to heart disease. This year he returned to running, as honorary captain of the Medtronic Twin Cities Marathon, running with the help of implants from the Medtronic Foundation. Alberto Salazar, world renowned marathon runner and winner of three consecutive New York City marathons, suffered a heart attack last year due to a genetic predisposition to heart disease. This year he returned to running, as honorary captain of the Medtronic Twin Cities Marathon, running with the help of implants from the Medtronic Foundation. Meshmonster Meshmonster alberto salazar heart disease marathon new york city marathon running nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Hermove.com Helps Women Dealing With Breast Cancer Wed, 15 Oct 2008 17:53:59 -0800

Author: Meshmonster
Added: Wed, 15 Oct 2008 17:53:59 -0800
Duration: 70

October is Breast Cancer Awareness Month. Now there is a new resource to help women and their loved ones cope with breast cancer - hermove.com.

]]> awarenessbreastcancermonth http://revver.com/video/1247807/hermovecom-helps-women-dealing-with-breast-cancer/ http://revver.com/watch/1247807 Hermove.com Helps Women Dealing With Breast Cancer October is Breast Cancer Awareness Month. Now there is a new resource to help women and their loved ones cope with breast cancer - hermove.com. October is Breast Cancer Awareness Month. Now there is a new resource to help women and their loved ones cope with breast cancer - hermove.com. Meshmonster Meshmonster awareness breast cancer month nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Historian Chris Epting at the P.T. Barnum Museum Wed, 15 Oct 2008 16:34:46 -0800

Author: Meshmonster
Added: Wed, 15 Oct 2008 16:34:46 -0800
Duration: 77

Pop Historian and author Chris Epting talks about P.T. Barnum and how Hampton Hotel's Save a Landmark program is working to ensure that his legacy lives on.

]]> barnumchriscircuseptinglandmarkmuseumptsave http://revver.com/video/1247592/historian-chris-epting-at-the-pt-barnum-museum/ http://revver.com/watch/1247592 Historian Chris Epting at the P.T. Barnum Museum Pop Historian and author Chris Epting talks about P.T. Barnum and how Hampton Hotel's Save a Landmark program is working to ensure that his legacy lives on. Pop Historian and author Chris Epting talks about P.T. Barnum and how Hampton Hotel's Save a Landmark program is working to ensure that his legacy lives on. Meshmonster Meshmonster barnum chris circus epting landmark museum pt save nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ 50th Anniversary of NASA Tue, 07 Oct 2008 17:53:11 -0800

Author: Meshmonster
Added: Tue, 07 Oct 2008 17:53:11 -0800
Duration: 84

October is the 50th anniversary of NASA. Commander Eugene Cernan walked on the lunar surface as part of the Apollo 17 mission in 1972. Now he is aspiring the future to go to the moon and beyond. NASA plans to return to the moon in the 2018.

]]> 17apollocernaneugeneexplorationnasaspace http://revver.com/video/1227847/50th-anniversary-of-nasa/ http://revver.com/watch/1227847 50th Anniversary of NASA October is the 50th anniversary of NASA. Commander Eugene Cernan walked on the lunar surface as part of the Apollo 17 mission in 1972. Now he is aspiring the future to go to the moon and beyond. NASA plans to return to the moon in the 2018. October is the 50th anniversary of NASA. Commander Eugene Cernan walked on the lunar surface as part of the Apollo 17 mission in 1972. Now he is aspiring the future to go to the moon and beyond. NASA plans to return to the moon in the 2018. Meshmonster Meshmonster 17 apollo cernan eugene exploration nasa space nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ NFL Quarterback David Garrard - Overcoming Crohn's Disease Wed, 24 Sep 2008 10:53:19 -0800

Author: Meshmonster
Added: Wed, 24 Sep 2008 10:53:19 -0800
Duration: 94

David Garrard will begin his 7th season with the Jacksonville Jaguars and his 2nd straight season as the team's starting quarterback. David had to overcome Crohn's disease, a debilitating gastronintestinal illness.

]]> crohns diseasedavid garrardfootballjacksonvillejaguars http://revver.com/video/1198932/nfl-quarterback-david-garrard-overcoming-crohns-disease/ http://revver.com/watch/1198932 NFL Quarterback David Garrard - Overcoming Crohn's Disease David Garrard will begin his 7th season with the Jacksonville Jaguars and his 2nd straight season as the team's starting quarterback. David had to overcome Crohn's disease, a debilitating gastronintestinal illness. David Garrard will begin his 7th season with the Jacksonville Jaguars and his 2nd straight season as the team's starting quarterback. David had to overcome Crohn's disease, a debilitating gastronintestinal illness. Meshmonster Meshmonster crohns disease david garrard football jacksonville jaguars nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mike Tringale on Managing Fall Allergy Symptoms Tue, 23 Sep 2008 20:34:03 -0800

Author: Meshmonster
Added: Tue, 23 Sep 2008 20:34:03 -0800
Duration: 70

The fall allergy season can have a greater impact on allergy sufferers than the springtime season in many cities. New medications are now available this fall to alleviate allergy symptoms. This video features AAFA spokesperson Mike Tringale.

]]> allergiescitiesdrugsfall alergiesmedicationsmike tringalezyrtec http://revver.com/video/1193811/mike-tringale-on-managing-fall-allergy-symptoms/ http://revver.com/watch/1193811 Mike Tringale on Managing Fall Allergy Symptoms The fall allergy season can have a greater impact on allergy sufferers than the springtime season in many cities. New medications are now available this fall to alleviate allergy symptoms. This video features AAFA spokesperson Mike Tringale. The fall allergy season can have a greater impact on allergy sufferers than the springtime season in many cities. New medications are now available this fall to alleviate allergy symptoms. This video features AAFA spokesperson Mike Tringale. Meshmonster Meshmonster allergies cities drugs fall alergies medications mike tringale zyrtec nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ 7 Time NBA All-Star Grant Hill Helps fight MRSA Fri, 19 Sep 2008 15:52:52 -0800

Author: Meshmonster
Added: Fri, 19 Sep 2008 15:52:52 -0800
Duration: 98

MRSA is an antibiotic resitant staph infection. In 2003 NBA All-Star Grant Hill was sidelined with a MRSA infection. He now helps educate the public on how to prevent its spread.

]]> all-starcloroxgrant hillmrsanbastaph infection http://revver.com/video/1188652/7-time-nba-all-star-grant-hill-helps-fight-mrsa/ http://revver.com/watch/1188652 7 Time NBA All-Star Grant Hill Helps fight MRSA MRSA is an antibiotic resitant staph infection. In 2003 NBA All-Star Grant Hill was sidelined with a MRSA infection. He now helps educate the public on how to prevent its spread. MRSA is an antibiotic resitant staph infection. In 2003 NBA All-Star Grant Hill was sidelined with a MRSA infection. He now helps educate the public on how to prevent its spread. Meshmonster Meshmonster all-star clorox grant hill mrsa nba staph infection nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Coupon Mom Stephanie Nelson - Online Coupons Fri, 19 Sep 2008 13:52:53 -0800

Author: Meshmonster
Added: Fri, 19 Sep 2008 13:52:53 -0800
Duration: 79

Coupon Mom Stephanie Nelson knows that when the economy is down, the number of coupons clipped goes up. Stephanie shares her favorite online coupon websites.

]]> coupon momcouponsonline couponssave moneyshoppingstephanie nelson http://revver.com/video/1188177/coupon-mom-stephanie-nelson-online-coupons/ http://revver.com/watch/1188177 Coupon Mom Stephanie Nelson - Online Coupons Coupon Mom Stephanie Nelson knows that when the economy is down, the number of coupons clipped goes up. Stephanie shares her favorite online coupon websites. Coupon Mom Stephanie Nelson knows that when the economy is down, the number of coupons clipped goes up. Stephanie shares her favorite online coupon websites. Meshmonster Meshmonster coupon mom coupons online coupons save money shopping stephanie nelson nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Atlanta Falcon Ovie Mughelli's Tailgating Tips Thu, 18 Sep 2008 12:36:38 -0800

Author: Meshmonster
Added: Thu, 18 Sep 2008 12:36:38 -0800
Duration: 53

Ovie Mughelli tells viewers where to get everything they will need in order to go tailgating this fall.

]]> atlanta falconsfootballovie mughellitailgating http://revver.com/video/1185739/atlanta-falcon-ovie-mughellis-tailgating-tips/ http://revver.com/watch/1185739 Atlanta Falcon Ovie Mughelli's Tailgating Tips Ovie Mughelli tells viewers where to get everything they will need in order to go tailgating this fall. Ovie Mughelli tells viewers where to get everything they will need in order to go tailgating this fall. Meshmonster Meshmonster atlanta falcons football ovie mughelli tailgating nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Archie Manning - Win Tickets to the Super Bowl Fri, 12 Sep 2008 17:55:12 -0800

Author: Meshmonster
Added: Fri, 12 Sep 2008 17:55:12 -0800
Duration: 71

Archie Manning sons, Eli and Payton, are Super Bowl MVP's. Taking pictures of his sons on the field has become Archie's new passion. Archie has teamed up with Canon for their 4th annual photo contest. The prize is tickets to the Super Bowl.

]]> archiebowlcanoncontestmanningphotographysuperticketsto http://revver.com/video/1163741/archie-manning-win-tickets-to-the-super-bowl/ http://revver.com/watch/1163741 Archie Manning - Win Tickets to the Super Bowl Archie Manning sons, Eli and Payton, are Super Bowl MVP's. Taking pictures of his sons on the field has become Archie's new passion. Archie has teamed up with Canon for their 4th annual photo contest. The prize is tickets to the Super Bowl. Archie Manning sons, Eli and Payton, are Super Bowl MVP's. Taking pictures of his sons on the field has become Archie's new passion. Archie has teamed up with Canon for their 4th annual photo contest. The prize is tickets to the Super Bowl. Meshmonster Meshmonster archie bowl canon contest manning photography super tickets to nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Archie Manning - Win Tickets to the Super Bowl Fri, 12 Sep 2008 17:55:12 -0800

Author: Meshmonster
Added: Fri, 12 Sep 2008 17:55:12 -0800
Duration: 71

Archie Manning sons, Eli and Payton, are Super Bowl MVP's. Taking pictures of his sons on the field has become Archie's new passion. Archie has teamed up with Canon for their 4th annual photo contest. The prize is tickets to the Super Bowl.

]]> archie manningcanoncontestphotographysuper bowltickets to the super bowl http://revver.com/video/1172465/archie-manning-win-tickets-to-the-super-bowl/ http://revver.com/watch/1172465 Archie Manning - Win Tickets to the Super Bowl Archie Manning sons, Eli and Payton, are Super Bowl MVP's. Taking pictures of his sons on the field has become Archie's new passion. Archie has teamed up with Canon for their 4th annual photo contest. The prize is tickets to the Super Bowl. Archie Manning sons, Eli and Payton, are Super Bowl MVP's. Taking pictures of his sons on the field has become Archie's new passion. Archie has teamed up with Canon for their 4th annual photo contest. The prize is tickets to the Super Bowl. Meshmonster Meshmonster archie manning canon contest photography super bowl tickets to the super bowl nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Jake Gibb and Sean Rosenthal - behospitabletraveler.com Thu, 28 Aug 2008 16:35:12 -0800

Author: Meshmonster
Added: Thu, 28 Aug 2008 16:35:12 -0800
Duration: 95

Prior to the 2008 games, Hilton Hotels 'Be Hospitable Traveler' program offered a prep course on Chinese Etiquette. Featuring Beach Volley ball athletes Jake Gibb and Sean Rosenthal.

]]> 2008ballbeachbeijinggamesgibbjakeolympicsrosenthalseanvolley http://revver.com/video/1137969/jake-gibb-and-sean-rosenthal-behospitabletravelercom/ http://revver.com/watch/1137969 Jake Gibb and Sean Rosenthal - behospitabletraveler.com Prior to the 2008 games, Hilton Hotels 'Be Hospitable Traveler' program offered a prep course on Chinese Etiquette. Featuring Beach Volley ball athletes Jake Gibb and Sean Rosenthal. Prior to the 2008 games, Hilton Hotels 'Be Hospitable Traveler' program offered a prep course on Chinese Etiquette. Featuring Beach Volley ball athletes Jake Gibb and Sean Rosenthal. Meshmonster Meshmonster 2008 ball beach beijing games gibb jake olympics rosenthal sean volley nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Michael Phelps swims final lap in 'Swim to Beijing relay' Thu, 28 Aug 2008 16:35:12 -0800

Author: Meshmonster
Added: Thu, 28 Aug 2008 16:35:12 -0800
Duration: 95

After winning an amazing eight Olympic gold medals, Michael Phelps swam the final lap in Hilton's 'Swim to Beijing Relay'. The relay benefits swimming education programs across the United States.

]]> 2008beijingmichaelolympicsphelpsswimming http://revver.com/video/1138004/michael-phelps-swims-final-lap-in-swim-to-beijing-relay/ http://revver.com/watch/1138004 Michael Phelps swims final lap in 'Swim to Beijing relay' After winning an amazing eight Olympic gold medals, Michael Phelps swam the final lap in Hilton's 'Swim to Beijing Relay'. The relay benefits swimming education programs across the United States. After winning an amazing eight Olympic gold medals, Michael Phelps swam the final lap in Hilton's 'Swim to Beijing Relay'. The relay benefits swimming education programs across the United States. Meshmonster Meshmonster 2008 beijing michael olympics phelps swimming nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Lee Corso - College Football Predictions Wed, 27 Aug 2008 16:36:26 -0800

Author: Meshmonster
Added: Wed, 27 Aug 2008 16:36:26 -0800
Duration: 117

Lee Corso, ESPN College Football Analyst, makes college football predictions and promotes College Colors Day (collegecolorsday.com).

]]> collegecolorscorsodayfootballleepredictions http://revver.com/video/1135579/lee-corso-college-football-predictions/ http://revver.com/watch/1135579 Lee Corso - College Football Predictions Lee Corso, ESPN College Football Analyst, makes college football predictions and promotes College Colors Day (collegecolorsday.com). Lee Corso, ESPN College Football Analyst, makes college football predictions and promotes College Colors Day (collegecolorsday.com). Meshmonster Meshmonster college colors corso day football lee predictions nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Parenting Expert & Author Stacey Debroff - Teaching Children Manners Fri, 22 Aug 2008 16:35:56 -0800

Author: Meshmonster
Added: Fri, 22 Aug 2008 16:35:56 -0800
Duration: 57

Stacy DeBroff says repetition is the key to succussfully teaching social skills to children. A series of new games for children, Noodleboro, uses repetition in an innovative way.

]]> childrenhasbronoodleboroparentingskillssocial http://revver.com/video/1125921/parenting-expert-author-stacey-debroff-teaching-children-manners/ http://revver.com/watch/1125921 Parenting Expert & Author Stacey Debroff - Teaching Children Manners Stacy DeBroff says repetition is the key to succussfully teaching social skills to children. A series of new games for children, Noodleboro, uses repetition in an innovative way. Stacy DeBroff says repetition is the key to succussfully teaching social skills to children. A series of new games for children, Noodleboro, uses repetition in an innovative way. Meshmonster Meshmonster children hasbro noodleboro parenting skills social nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Olympic Track Star Lauryn Williams - AmericasCheer.com Fri, 22 Aug 2008 16:35:56 -0800

Author: Meshmonster
Added: Fri, 22 Aug 2008 16:35:56 -0800
Duration: 61

She nabbed the 100-meter silver medal in Athens, and silver at the 2007 World Championships. Lauryn Williams narrowly missed bronze at the 2008 Olympic Games. Bank of America's Americas Cheer, allows everyone to support our athletes in Beijing.

]]> americasbeijingcheerlaurynolympicstrackwilliams http://revver.com/video/1125882/olympic-track-star-lauryn-williams-americascheercom/ http://revver.com/watch/1125882 Olympic Track Star Lauryn Williams - AmericasCheer.com She nabbed the 100-meter silver medal in Athens, and silver at the 2007 World Championships. Lauryn Williams narrowly missed bronze at the 2008 Olympic Games. Bank of America's Americas Cheer, allows everyone to support our athletes in Beijing. She nabbed the 100-meter silver medal in Athens, and silver at the 2007 World Championships. Lauryn Williams narrowly missed bronze at the 2008 Olympic Games. Bank of America's Americas Cheer, allows everyone to support our athletes in Beijing. Meshmonster Meshmonster americas beijing cheer lauryn olympics track williams nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Olympic Gymnast Kerri Strug - AmericasCheer.com Wed, 20 Aug 2008 11:54:58 -0800

Author: Meshmonster
Added: Wed, 20 Aug 2008 11:54:58 -0800
Duration: 59

Olympic Gymnast Kerri Strug remembers how people cheered her on during the 96 Atlanta Games. Now, Kerri is encouraging everyone to do the same for the athletes in Beijing by visiting Bank of America's website AmericasCheer.com.

]]> americaamericascheercomathletesbeijingkerriolympicsstrug http://revver.com/video/1121134/olympic-gymnast-kerri-strug-americascheercom/ http://revver.com/watch/1121134 Olympic Gymnast Kerri Strug - AmericasCheer.com Olympic Gymnast Kerri Strug remembers how people cheered her on during the 96 Atlanta Games. Now, Kerri is encouraging everyone to do the same for the athletes in Beijing by visiting Bank of America's website AmericasCheer.com. Olympic Gymnast Kerri Strug remembers how people cheered her on during the 96 Atlanta Games. Now, Kerri is encouraging everyone to do the same for the athletes in Beijing by visiting Bank of America's website AmericasCheer.com. Meshmonster Meshmonster america americascheercom athletes beijing kerri olympics strug nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Steven Raichlen, Author of The Barbeque Bible, on Tailgating Mon, 18 Aug 2008 09:54:50 -0800

Author: Meshmonster
Added: Mon, 18 Aug 2008 09:54:50 -0800
Duration: 92

The host of PBS's Primal Grill and Barbecue University, Steven Raichlen, shares with us the necessary tools and top safety tips that will make your tailgating experience the best ever.

]]> barbequecookinggrillgrillingtailgating http://revver.com/video/1116168/steven-raichlen-author-of-the-barbeque-bible-on-tailgating/ http://revver.com/watch/1116168 Steven Raichlen, Author of The Barbeque Bible, on Tailgating The host of PBS's Primal Grill and Barbecue University, Steven Raichlen, shares with us the necessary tools and top safety tips that will make your tailgating experience the best ever. The host of PBS's Primal Grill and Barbecue University, Steven Raichlen, shares with us the necessary tools and top safety tips that will make your tailgating experience the best ever. Meshmonster Meshmonster barbeque cooking grill grilling tailgating nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Diana Lopez of the U.S. Olympic Taekwondo Team Thu, 14 Aug 2008 08:34:56 -0800

Author: Meshmonster
Added: Thu, 14 Aug 2008 08:34:56 -0800
Duration: 102

Siblings Steven, Mark and Diana Lopez are all Team USA members in the sport of Taekwondo. The Hilton Family of hotels are providing her parents with a hotel and three meals a day so that the entire family is able to be together at the games.

]]> beijingdianagameslopezmarkolympicssteventaekwondo http://revver.com/video/1108501/diana-lopez-of-the-us-olympic-taekwondo-team/ http://revver.com/watch/1108501 Diana Lopez of the U.S. Olympic Taekwondo Team Siblings Steven, Mark and Diana Lopez are all Team USA members in the sport of Taekwondo. The Hilton Family of hotels are providing her parents with a hotel and three meals a day so that the entire family is able to be together at the games. Siblings Steven, Mark and Diana Lopez are all Team USA members in the sport of Taekwondo. The Hilton Family of hotels are providing her parents with a hotel and three meals a day so that the entire family is able to be together at the games. Meshmonster Meshmonster beijing diana games lopez mark olympics steven taekwondo nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Oympian Dan O'Brien on Good Year Get There Awards Fri, 01 Aug 2008 16:33:50 -0800

Author: Meshmonster
Added: Fri, 01 Aug 2008 16:33:50 -0800
Duration: 79

Dan OBrien, failed in his bid in 1992 to make the Olympic Games, came back in 1996 to win the gold medal. Dan knows the support he received helped him to achieve his goal. That is why he is part of the Goodyear Get There Awards Program.

]]> athletesawardsdangamesgetgoodobrienolympicthereyear http://revver.com/video/1079412/oympian-dan-obrien-on-good-year-get-there-awards/ http://revver.com/watch/1079412 Oympian Dan O'Brien on Good Year Get There Awards Dan OBrien, failed in his bid in 1992 to make the Olympic Games, came back in 1996 to win the gold medal. Dan knows the support he received helped him to achieve his goal. That is why he is part of the Goodyear Get There Awards Program. Dan OBrien, failed in his bid in 1992 to make the Olympic Games, came back in 1996 to win the gold medal. Dan knows the support he received helped him to achieve his goal. That is why he is part of the Goodyear Get There Awards Program. Meshmonster Meshmonster athletes awards dan games get good obrien olympic there year nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Dr. Jennifer Shu on Mommy Lunchbox Makeover Fri, 01 Aug 2008 04:34:01 -0800

Author: Meshmonster
Added: Fri, 01 Aug 2008 04:34:01 -0800
Duration: 81

Dr. Jennifer Shu gives tips on nutritional and tasty foods for children to take to school in their lunchboxes.

]]> childrenfoodjenniferlunchlunchboxnutritionschoolshu http://revver.com/video/1077542/dr-jennifer-shu-on-mommy-lunchbox-makeover/ http://revver.com/watch/1077542 Dr. Jennifer Shu on Mommy Lunchbox Makeover Dr. Jennifer Shu gives tips on nutritional and tasty foods for children to take to school in their lunchboxes. Dr. Jennifer Shu gives tips on nutritional and tasty foods for children to take to school in their lunchboxes. Meshmonster Meshmonster children food jennifer lunch lunchbox nutrition school shu nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Historian Chris Epting - Amelia Earhart Tue, 29 Jul 2008 20:33:37 -0800

Author: Meshmonster
Added: Tue, 29 Jul 2008 20:33:37 -0800
Duration: 63

More than 70 years after her mysterious disappearance we still remember the name of Amelia Earhart. And that memory is getting some tender loving care, as INN's David Morris reports.

]]> ameliaaviationdavidearharthamptoninnlandmarkmorrismysteriesmysterysave http://revver.com/video/1073015/historian-chris-epting-amelia-earhart/ http://revver.com/watch/1073015 Historian Chris Epting - Amelia Earhart More than 70 years after her mysterious disappearance we still remember the name of Amelia Earhart. And that memory is getting some tender loving care, as INN's David Morris reports. More than 70 years after her mysterious disappearance we still remember the name of Amelia Earhart. And that memory is getting some tender loving care, as INN's David Morris reports. Meshmonster Meshmonster amelia aviation david earhart hampton inn landmark morris mysteries mystery save nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Jeff Skiba, Ronda Rousey, Home Depot Job Opportunity Program Thu, 24 Jul 2008 14:55:29 -0800

Author: Meshmonster
Added: Thu, 24 Jul 2008 14:55:29 -0800
Duration: 57

Para athlete Jeff Skiba and Judo hopeful Ronda Rousey work for Home Depot as part of Home Depot's Olympic Job Opportunity Program which pays athletes a full time wage who are working part time hours and training at the same time for their sport.

]]> depothomejeffolympicsrondarouseyskiba http://revver.com/video/1062791/jeff-skiba-ronda-rousey-home-depot-job-opportunity-program/ http://revver.com/watch/1062791 Jeff Skiba, Ronda Rousey, Home Depot Job Opportunity Program Para athlete Jeff Skiba and Judo hopeful Ronda Rousey work for Home Depot as part of Home Depot's Olympic Job Opportunity Program which pays athletes a full time wage who are working part time hours and training at the same time for their sport. Para athlete Jeff Skiba and Judo hopeful Ronda Rousey work for Home Depot as part of Home Depot's Olympic Job Opportunity Program which pays athletes a full time wage who are working part time hours and training at the same time for their sport. Meshmonster Meshmonster depot home jeff olympics ronda rousey skiba nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Harley Davidson Museum Opens in Milwaukee Fri, 18 Jul 2008 17:54:49 -0800

Author: Meshmonster
Added: Fri, 18 Jul 2008 17:54:49 -0800
Duration: 91

Milwaukee's new Harley Davidson Museum is over 130,000 square feet and features over 400 motorcycles on display, as well as a wealth of artifacts, posters, clothes, trophies and more.

]]> davidsonharleymilwaukeemotorcylesmuseum http://revver.com/video/1049493/harley-davidson-museum-opens-in-milwaukee/ http://revver.com/watch/1049493 Harley Davidson Museum Opens in Milwaukee Milwaukee's new Harley Davidson Museum is over 130,000 square feet and features over 400 motorcycles on display, as well as a wealth of artifacts, posters, clothes, trophies and more. Milwaukee's new Harley Davidson Museum is over 130,000 square feet and features over 400 motorcycles on display, as well as a wealth of artifacts, posters, clothes, trophies and more. Meshmonster Meshmonster davidson harley milwaukee motorcyles museum nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Steve Ely - EQuifax ID Patrol Protects Against ID Theft Thu, 17 Jul 2008 17:54:40 -0800

Author: Meshmonster
Added: Thu, 17 Jul 2008 17:54:40 -0800
Duration: 46

According to Dept. of Justice, ID theft has surpassed drug trafficking as the number 1 crime in America. Steve Ely, President of Consumer Business for Equifax advises protecting yourself by purchasing Equifax ID Patrol.

]]> elyequifaxididentificationprotectstevetheft http://revver.com/video/1047021/steve-ely-equifax-id-patrol-protects-against-id-theft/ http://revver.com/watch/1047021 Steve Ely - EQuifax ID Patrol Protects Against ID Theft According to Dept. of Justice, ID theft has surpassed drug trafficking as the number 1 crime in America. Steve Ely, President of Consumer Business for Equifax advises protecting yourself by purchasing Equifax ID Patrol. According to Dept. of Justice, ID theft has surpassed drug trafficking as the number 1 crime in America. Steve Ely, President of Consumer Business for Equifax advises protecting yourself by purchasing Equifax ID Patrol. Meshmonster Meshmonster ely equifax id identification protect steve theft nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mott's Plus Apple Sauce - Eat Like a Hot Chick Thu, 17 Jul 2008 14:39:45 -0800

Author: Meshmonster
Added: Thu, 17 Jul 2008 14:39:45 -0800
Duration: 51

You can keep your swimsuit look year round by picking snacks that work harder for you. The authors OF "How to Eat Like a Hot CHick," Jodi Lipper and Cerina Vincent have a new favorite thing; Mott's Plus Apple Sauce.

]]> cerinachickdieteathothowjodilikelippermottsnutritiontovincent http://revver.com/video/1046924/motts-plus-apple-sauce-eat-like-a-hot-chick/ http://revver.com/watch/1046924 Mott's Plus Apple Sauce - Eat Like a Hot Chick You can keep your swimsuit look year round by picking snacks that work harder for you. The authors OF "How to Eat Like a Hot CHick," Jodi Lipper and Cerina Vincent have a new favorite thing; Mott's Plus Apple Sauce. You can keep your swimsuit look year round by picking snacks that work harder for you. The authors OF "How to Eat Like a Hot CHick," Jodi Lipper and Cerina Vincent have a new favorite thing; Mott's Plus Apple Sauce. Meshmonster Meshmonster cerina chick diet eat hot how jodi like lipper motts nutrition to vincent nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Kevin Harvick, Penzoil and the Clean Change Campaign Wed, 09 Jul 2008 17:39:36 -0800

Author: Meshmonster
Added: Wed, 09 Jul 2008 17:39:36 -0800
Duration: 52

Richard Childress has 2 of his 3 drivers in the season ending Chase for the Championship. Kevin Harvick, his other driver, is just tow points out of the last spot. Last week Harvick and his sponsor, Pennzoil rolled out the “Clean Change Campaign.”

]]> 400bushcampaignchampionshipchangechasechildresscleancokeforharvickkevinkylepenzoilrichardzero http://revver.com/video/1026941/kevin-harvick-penzoil-and-the-clean-change-campaign/ http://revver.com/watch/1026941 Kevin Harvick, Penzoil and the Clean Change Campaign Richard Childress has 2 of his 3 drivers in the season ending Chase for the Championship. Kevin Harvick, his other driver, is just tow points out of the last spot. Last week Harvick and his sponsor, Pennzoil rolled out the “Clean Change Campaign.” Richard Childress has 2 of his 3 drivers in the season ending Chase for the Championship. Kevin Harvick, his other driver, is just tow points out of the last spot. Last week Harvick and his sponsor, Pennzoil rolled out the “Clean Change Campaign.” Meshmonster Meshmonster 400 bush campaign championship change chase childress clean coke for harvick kevin kyle penzoil richard zero nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Hydration: An Important Part of Summer Training Wed, 09 Jul 2008 12:34:34 -0800

Author: Meshmonster
Added: Wed, 09 Jul 2008 12:34:34 -0800
Duration: 71

Americans will engage in outdoor activities such as a quick walk, run, swim or bike ride this summer. Even If we are not training for the U.S. Olympic team, we can at least train like Olympic winners by staying hydrated.

]]> bikehydratedhydrationolympicrunsportsswimtraining http://revver.com/video/1026273/hydration-an-important-part-of-summer-training/ http://revver.com/watch/1026273 Hydration: An Important Part of Summer Training Americans will engage in outdoor activities such as a quick walk, run, swim or bike ride this summer. Even If we are not training for the U.S. Olympic team, we can at least train like Olympic winners by staying hydrated. Americans will engage in outdoor activities such as a quick walk, run, swim or bike ride this summer. Even If we are not training for the U.S. Olympic team, we can at least train like Olympic winners by staying hydrated. Meshmonster Meshmonster bike hydrated hydration olympic run sports swim training nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Congressman Filner - Extend Service Members Civil Relief Act Fri, 20 Jun 2008 04:39:30 -0800

Author: Meshmonster
Added: Fri, 20 Jun 2008 04:39:30 -0800
Duration: 52

California Congressman Bobby Filner proposes extending the Service Members Civil Relief Act designed to protect soldiers from losing their homes for not paying their mortgages from 90 days to a year.

]]> actbobbycivilcongressevictionsfilnerforeclosureshomesmembersreliefserviceveterans http://revver.com/video/973227/congressman-filner-extend-service-members-civil-relief-act/ http://revver.com/watch/973227 Congressman Filner - Extend Service Members Civil Relief Act California Congressman Bobby Filner proposes extending the Service Members Civil Relief Act designed to protect soldiers from losing their homes for not paying their mortgages from 90 days to a year. California Congressman Bobby Filner proposes extending the Service Members Civil Relief Act designed to protect soldiers from losing their homes for not paying their mortgages from 90 days to a year. Meshmonster Meshmonster act bobby civil congress evictions filner foreclosures homes members relief service veterans nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Congressman Filner - Extend Service Members Civil Relief Act Fri, 20 Jun 2008 04:39:30 -0800

Author: Meshmonster
Added: Fri, 20 Jun 2008 04:39:30 -0800
Duration: 52

California Congressman Bobby Filner proposes extending the Service Members Civil Relief Act designed to protect soldiers from losing their homes for not paying their mortgages from 90 days to a year.

]]> actbobbycivilcongressevictionsfilnerforeclosureshomesmembersreliefserviceveterans http://revver.com/video/972259/congressman-filner-extend-service-members-civil-relief-act/ http://revver.com/watch/972259 Congressman Filner - Extend Service Members Civil Relief Act California Congressman Bobby Filner proposes extending the Service Members Civil Relief Act designed to protect soldiers from losing their homes for not paying their mortgages from 90 days to a year. California Congressman Bobby Filner proposes extending the Service Members Civil Relief Act designed to protect soldiers from losing their homes for not paying their mortgages from 90 days to a year. Meshmonster Meshmonster act bobby civil congress evictions filner foreclosures homes members relief service veterans nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Golf Pro Peter Jacobsen - \"Hook a Kid on Golf\" Program Mon, 16 Jun 2008 12:25:10 -0800

Author: Meshmonster
Added: Mon, 16 Jun 2008 12:25:10 -0800
Duration: 56

Golf pro Peter Jacobsen is helping the USGA & Lexus announce plans to grow the game of golf by supporting the “Hook a Kid on Golf” program.

]]> golfhookjacobsenkidlexusonpeterusga http://revver.com/video/963135/golf-pro-peter-jacobsen-hook-a-kid-on-golf-program/ http://revver.com/watch/963135 Golf Pro Peter Jacobsen - \"Hook a Kid on Golf\" Program Golf pro Peter Jacobsen is helping the USGA & Lexus announce plans to grow the game of golf by supporting the “Hook a Kid on Golf” program. Golf pro Peter Jacobsen is helping the USGA & Lexus announce plans to grow the game of golf by supporting the “Hook a Kid on Golf” program. Meshmonster Meshmonster golf hook jacobsen kid lexus on peter usga nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Summer Travel Tips for Affordable Family Vacations Fri, 13 Jun 2008 17:09:13 -0800

Author: Meshmonster
Added: Fri, 13 Jun 2008 17:09:13 -0800
Duration: 172

Colleen Burns, producer of the nationally-syndicated Emmy Award winning show "Smarter Living provides hidden tricks to save money and make tradeoffs, no matter where you travel this summer.

]]> budgetcheapfamilysave moneysummer traveltipstravelvacation http://revver.com/video/957154/summer-travel-tips-for-affordable-family-vacations/ http://revver.com/watch/957154 Summer Travel Tips for Affordable Family Vacations Colleen Burns, producer of the nationally-syndicated Emmy Award winning show "Smarter Living provides hidden tricks to save money and make tradeoffs, no matter where you travel this summer. Colleen Burns, producer of the nationally-syndicated Emmy Award winning show "Smarter Living provides hidden tricks to save money and make tradeoffs, no matter where you travel this summer. Meshmonster Meshmonster budget cheap family save money summer travel tips travel vacation nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Pet Expert Charlotte Reed Gives Advice on Marriage & Pets Fri, 13 Jun 2008 03:07:36 -0800

Author: Meshmonster
Added: Fri, 13 Jun 2008 03:07:36 -0800
Duration: 80

Pet Expert and Author Charlotte Reed gives advice to newlyweds about how to help your two-legged and four-legged family members get along. For more information, log on to missfidomanners.com.

]]> catsdogshouseholdlivingmarriagenewlywedspetpetsproblemstipstogetherwith http://revver.com/video/955705/pet-expert-charlotte-reed-gives-advice-on-marriage-pets/ http://revver.com/watch/955705 Pet Expert Charlotte Reed Gives Advice on Marriage & Pets Pet Expert and Author Charlotte Reed gives advice to newlyweds about how to help your two-legged and four-legged family members get along. For more information, log on to missfidomanners.com. Pet Expert and Author Charlotte Reed gives advice to newlyweds about how to help your two-legged and four-legged family members get along. For more information, log on to missfidomanners.com. Meshmonster Meshmonster cats dogs household living marriage newlyweds pet pets problems tips together with nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Father's Day Gift Suggestions Thu, 12 Jun 2008 14:26:25 -0800

Author: Meshmonster
Added: Thu, 12 Jun 2008 14:26:25 -0800
Duration: 164

Richard Croker Author of Boomer Century provides Father's Day gift suggestions.

]]> babyboomerboomerscenturycrokerdayfathersgiftsrichard http://revver.com/video/955192/fathers-day-gift-suggestions/ http://revver.com/watch/955192 Father's Day Gift Suggestions Richard Croker Author of Boomer Century provides Father's Day gift suggestions. Richard Croker Author of Boomer Century provides Father's Day gift suggestions. Meshmonster Meshmonster baby boomer boomers century croker day fathers gifts richard nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Wendy’s 2nd annual Father’s Day Frosty Weekend Thu, 12 Jun 2008 14:26:25 -0800

Author: Meshmonster
Added: Thu, 12 Jun 2008 14:26:25 -0800
Duration: 63

Wendy’s 2nd annual Father’s Day Frosty Weekend helps children find a permanent home. For more information, log on to davethomasfoundationforadoption.org.

]]> adoptiondayfathersfrostyweekendwendys http://revver.com/video/954972/wendys-2nd-annual-fathers-day-frosty-weekend/ http://revver.com/watch/954972 Wendy’s 2nd annual Father’s Day Frosty Weekend Wendy’s 2nd annual Father’s Day Frosty Weekend helps children find a permanent home. For more information, log on to davethomasfoundationforadoption.org. Wendy’s 2nd annual Father’s Day Frosty Weekend helps children find a permanent home. For more information, log on to davethomasfoundationforadoption.org. Meshmonster Meshmonster adoption day fathers frosty weekend wendys nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Gymnasts Morgan and Paul Hamm Join “Right to Play” Program Fri, 06 Jun 2008 16:34:49 -0800

Author: Meshmonster
Added: Fri, 06 Jun 2008 16:34:49 -0800
Duration: 69

Olympic Gymnasts Morgan and Paul Hamm speak about how they are busy helping kids all over the world in a program aimed at teaching them teamwork and building life skills. It’s part of a unique international program called “Right to Play.”

]]> athletesathleticsbeijingchildrengymnasticshammkidsmorganolymipicspaulplayrightto http://revver.com/video/941057/gymnasts-morgan-and-paul-hamm-join-right-to-play-program/ http://revver.com/watch/941057 Gymnasts Morgan and Paul Hamm Join “Right to Play” Program Olympic Gymnasts Morgan and Paul Hamm speak about how they are busy helping kids all over the world in a program aimed at teaching them teamwork and building life skills. It’s part of a unique international program called “Right to Play.” Olympic Gymnasts Morgan and Paul Hamm speak about how they are busy helping kids all over the world in a program aimed at teaching them teamwork and building life skills. It’s part of a unique international program called “Right to Play.” Meshmonster Meshmonster athletes athletics beijing children gymnastics hamm kids morgan olymipics paul play right to nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Traveling Exhibit Teaches Kids About Trees, Environment Thu, 29 May 2008 14:49:35 -0800

Author: Meshmonster
Added: Thu, 29 May 2008 14:49:35 -0800
Duration: 76

\"Exploring Trees Inside and Out\" begins its nationwide tour in St. Louis and will travel around the country teaching children the significant role that trees play in the environment.

]]> childreneducationenvironmentenvironmentalexhibitskidstrees http://revver.com/video/920910/traveling-exhibit-teaches-kids-about-trees-environment/ http://revver.com/watch/920910 Traveling Exhibit Teaches Kids About Trees, Environment \"Exploring Trees Inside and Out\" begins its nationwide tour in St. Louis and will travel around the country teaching children the significant role that trees play in the environment. \"Exploring Trees Inside and Out\" begins its nationwide tour in St. Louis and will travel around the country teaching children the significant role that trees play in the environment. Meshmonster Meshmonster children education environment environmental exhibits kids trees nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Kerri Strug & Bob Beamon - Visa's "Go World" Tue, 27 May 2008 07:52:37 -0800

Author: Meshmonster
Added: Tue, 27 May 2008 07:52:37 -0800
Duration: 95

Visa's "Go World" campaign highlights unforgettable Olympic moments. Olympic legends Kerri Strug and Bob Beamon are featured.

]]> beamonbobgokerriolympicsstrugvisaworld http://revver.com/video/915221/kerri-strug-bob-beamon-visa39s-go-world/ http://revver.com/watch/915221 Kerri Strug & Bob Beamon - Visa's "Go World" Visa's "Go World" campaign highlights unforgettable Olympic moments. Olympic legends Kerri Strug and Bob Beamon are featured. Visa's "Go World" campaign highlights unforgettable Olympic moments. Olympic legends Kerri Strug and Bob Beamon are featured. Meshmonster Meshmonster beamon bob go kerri olympics strug visa world nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Emily Schreiber and BioGuard Fight Cystic Fibrosis Fri, 23 May 2008 10:49:34 -0800

Author: Meshmonster
Added: Fri, 23 May 2008 10:49:34 -0800
Duration: 57

Bioguard and Emily Shreiver, a nine year old girl with Cystic Fibrosis, are participating in the \"Splash for CF\" fundraiser. Emily has raised 1.2 million dollars to date.

]]> bioguardcfcysticemilyfibrosisshreiversplash http://revver.com/video/908633/emily-schreiber-and-bioguard-fight-cystic-fibrosis/ http://revver.com/watch/908633 Emily Schreiber and BioGuard Fight Cystic Fibrosis Bioguard and Emily Shreiver, a nine year old girl with Cystic Fibrosis, are participating in the \"Splash for CF\" fundraiser. Emily has raised 1.2 million dollars to date. Bioguard and Emily Shreiver, a nine year old girl with Cystic Fibrosis, are participating in the \"Splash for CF\" fundraiser. Emily has raised 1.2 million dollars to date. Meshmonster Meshmonster bioguard cf cystic emily fibrosis shreiver splash nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ CHEF VIRGINIA WILLIS HELPS WOMEN MASTER SUMMER GRILLING Wed, 21 May 2008 12:19:35 -0800

Author: Meshmonster
Added: Wed, 21 May 2008 12:19:35 -0800
Duration: 151

CHEF AND AUTHOR OF OF BON APPETIT, Y’ALL, VIRGINIA WILLIS wants women to stand up and take their rightful places as masters of the grill. Virginia says women pay more attention to detail and can concentrate on the entire presentation.

]]> barbequebarbequinggrillingsummervirginiawilliswomen http://revver.com/video/903484/chef-virginia-willis-helps-women-master-summer-grilling/ http://revver.com/watch/903484 CHEF VIRGINIA WILLIS HELPS WOMEN MASTER SUMMER GRILLING CHEF AND AUTHOR OF OF BON APPETIT, Y’ALL, VIRGINIA WILLIS wants women to stand up and take their rightful places as masters of the grill. Virginia says women pay more attention to detail and can concentrate on the entire presentation. CHEF AND AUTHOR OF OF BON APPETIT, Y’ALL, VIRGINIA WILLIS wants women to stand up and take their rightful places as masters of the grill. Virginia says women pay more attention to detail and can concentrate on the entire presentation. Meshmonster Meshmonster barbeque barbequing grilling summer virginia willis women nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ DHA Omega 3 Important for Brain Health Thu, 08 May 2008 12:49:45 -0800

Author: Meshmonster
Added: Thu, 08 May 2008 12:49:45 -0800
Duration: 50

Protein, vitamins and nutrients, from infancy to adulthood, play a significant role in overall health. Studies show most infant's diets are lacking in DHA Omega 3 Fatty Acid, a fatty acid that is believed to play an important role in brain health.

]]> acidsbrainchildrensdietsfattyhealthhorizoninfantsmilkorganic http://revver.com/video/872993/dha-omega-3-important-for-brain-health/ http://revver.com/watch/872993 DHA Omega 3 Important for Brain Health Protein, vitamins and nutrients, from infancy to adulthood, play a significant role in overall health. Studies show most infant's diets are lacking in DHA Omega 3 Fatty Acid, a fatty acid that is believed to play an important role in brain health. Protein, vitamins and nutrients, from infancy to adulthood, play a significant role in overall health. Studies show most infant's diets are lacking in DHA Omega 3 Fatty Acid, a fatty acid that is believed to play an important role in brain health. Meshmonster Meshmonster acids brain childrens diets fatty health horizon infants milk organic nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Teleflora Presents America's Favorite Mom Wed, 07 May 2008 13:16:20 -0800

Author: Meshmonster
Added: Wed, 07 May 2008 13:16:20 -0800
Duration: 59

This year is the 100th Anniversary of Mother's Day. Teleflora, the world's leading floral service, is running a contest, "America's Favorite Mom". Teleflora also sponsers the International Mother's Day Shrine in Grafton, West Virginia, the birthplace of Mother's Day.

]]> 100th anniversarymothers dayteleflora http://revver.com/video/869979/teleflora-presents-americas-favorite-mom/ http://revver.com/watch/869979 Teleflora Presents America's Favorite Mom This year is the 100th Anniversary of Mother's Day. Teleflora, the world's leading floral service, is running a contest, "America's Favorite Mom". Teleflora also sponsers the International Mother's Day Shrine in Grafton, West Virginia, the birthplace of Mother's Day. This year is the 100th Anniversary of Mother's Day. Teleflora, the world's leading floral service, is running a contest, "America's Favorite Mom". Teleflora also sponsers the International Mother's Day Shrine in Grafton, West Virginia, the birthplace of Mother's Day. Meshmonster Meshmonster 100th anniversary mothers day teleflora nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Teleflora Presents America's Favorite Mom Wed, 07 May 2008 12:49:33 -0800

Author: Meshmonster
Added: Wed, 07 May 2008 12:49:33 -0800
Duration: 59

This year is the 100th Anniversary of Mother's Day. Teleflora is running a contest, \"America's Favorite Mom\". Teleflora also sponsers the International Mother's Day Shrine in Grafton, WV, the birthplace of Mother's Day.

]]> 100thanniversarydaymothersteleflora http://revver.com/video/869953/teleflora-presents-america39s-favorite-mom/ http://revver.com/watch/869953 Teleflora Presents America's Favorite Mom This year is the 100th Anniversary of Mother's Day. Teleflora is running a contest, \"America's Favorite Mom\". Teleflora also sponsers the International Mother's Day Shrine in Grafton, WV, the birthplace of Mother's Day. This year is the 100th Anniversary of Mother's Day. Teleflora is running a contest, \"America's Favorite Mom\". Teleflora also sponsers the International Mother's Day Shrine in Grafton, WV, the birthplace of Mother's Day. Meshmonster Meshmonster 100th anniversary day mothers teleflora nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Finalists in 2008 Coca-Cola Scholars Awards Tue, 29 Apr 2008 14:49:31 -0800

Author: Meshmonster
Added: Tue, 29 Apr 2008 14:49:31 -0800
Duration: 49

250 High School Seniors chosen as finalists in the 2008 Coca-Cola Scholars program arrived in Atlanta on the weekend of April 27. Students are chosen on the basis of academic excellence, community involvement, and school leadership.

]]> (atlanta)(awards)(coca-cola)(scholars)(scholarship)(scholarships) http://revver.com/video/851417/finalists-in-2008-coca-cola-scholars-awards/ http://revver.com/watch/851417 Finalists in 2008 Coca-Cola Scholars Awards 250 High School Seniors chosen as finalists in the 2008 Coca-Cola Scholars program arrived in Atlanta on the weekend of April 27. Students are chosen on the basis of academic excellence, community involvement, and school leadership. 250 High School Seniors chosen as finalists in the 2008 Coca-Cola Scholars program arrived in Atlanta on the weekend of April 27. Students are chosen on the basis of academic excellence, community involvement, and school leadership. Meshmonster Meshmonster (atlanta) (awards) (coca-cola) (scholars) (scholarship) (scholarships) nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Retirees Moving Back into the Workforce Tue, 29 Apr 2008 14:19:30 -0800

Author: Meshmonster
Added: Tue, 29 Apr 2008 14:19:30 -0800
Duration: 61

People 65 and older are going back to work for a variety of reasons including uncertain economic times and longer life spans. Longer life spans make it harder for people to have the funds they need to last through their retirement years.

]]> (finances)(financial)(for)(planning)(retirement)(retiring)(saving)(wachovia) http://revver.com/video/851231/retirees-moving-back-into-the-workforce/ http://revver.com/watch/851231 Retirees Moving Back into the Workforce People 65 and older are going back to work for a variety of reasons including uncertain economic times and longer life spans. Longer life spans make it harder for people to have the funds they need to last through their retirement years. People 65 and older are going back to work for a variety of reasons including uncertain economic times and longer life spans. Longer life spans make it harder for people to have the funds they need to last through their retirement years. Meshmonster Meshmonster (finances) (financial) (for) (planning) (retirement) (retiring) (saving) (wachovia) nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ AirTran Celebrates Danica Patrick's Indy 300 Victory Tue, 22 Apr 2008 08:49:33 -0800

Author: Meshmonster
Added: Tue, 22 Apr 2008 08:49:33 -0800
Duration: 47

Danica Patrick became the 1st female winner in Indy Racing League history by capturning the Indy Japan 300 event. AirTran Airways Chairman Bob Fornaro declared monday, April 21'st as \"AirTranica\" day.

]]> 300airlinesairtrandanicaindypatrickracing http://revver.com/video/835369/airtran-celebrates-danica-patrick39s-indy-300-victory/ http://revver.com/watch/835369 AirTran Celebrates Danica Patrick's Indy 300 Victory Danica Patrick became the 1st female winner in Indy Racing League history by capturning the Indy Japan 300 event. AirTran Airways Chairman Bob Fornaro declared monday, April 21'st as \"AirTranica\" day. Danica Patrick became the 1st female winner in Indy Racing League history by capturning the Indy Japan 300 event. AirTran Airways Chairman Bob Fornaro declared monday, April 21'st as \"AirTranica\" day. Meshmonster Meshmonster 300 airlines airtran danica indy patrick racing nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Housing Survival Guide With Mike Ferrara Tue, 15 Apr 2008 14:25:36 -0800

Author: Meshmonster
Added: Tue, 15 Apr 2008 14:25:36 -0800
Duration: 68

With the housing market in a slump, it is more important than ever to make a good first impression on potential buyers. Lazy Homeowner Mike Ferrara provides tips on what to do and not to do.

]]> adviceferrarahomehousemikesellsellingtipsyour http://revver.com/video/818960/housing-survival-guide-with-mike-ferrara/ http://revver.com/watch/818960 Housing Survival Guide With Mike Ferrara With the housing market in a slump, it is more important than ever to make a good first impression on potential buyers. Lazy Homeowner Mike Ferrara provides tips on what to do and not to do. With the housing market in a slump, it is more important than ever to make a good first impression on potential buyers. Lazy Homeowner Mike Ferrara provides tips on what to do and not to do. Meshmonster Meshmonster advice ferrara home house mike sell selling tips your nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Carole O'Connell - Beat the Blues in an Unstable Economy Fri, 11 Apr 2008 15:22:30 -0800

Author: Meshmonster
Added: Fri, 11 Apr 2008 15:22:30 -0800
Duration: 223

In keeping with Women's nutrition Week, Life Coach Carole O'Connell provides tips and presents new products to help women avoid the recession depression.

]]> caroledepressioneconomylife-stylenutritionoconnellrecession http://revver.com/video/810380/carole-oconnell-beat-the-blues-in-an-unstable-economy/ http://revver.com/watch/810380 Carole O'Connell - Beat the Blues in an Unstable Economy In keeping with Women's nutrition Week, Life Coach Carole O'Connell provides tips and presents new products to help women avoid the recession depression. In keeping with Women's nutrition Week, Life Coach Carole O'Connell provides tips and presents new products to help women avoid the recession depression. Meshmonster Meshmonster carole depression economy life-style nutrition oconnell recession nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ America's Cheer Program Supports US Olympic Athletes Thu, 10 Apr 2008 10:49:34 -0800

Author: Meshmonster
Added: Thu, 10 Apr 2008 10:49:34 -0800
Duration: 65

Bank of America has established the \"America's Cheer Program\". Support your favorite athletes - contribute a video, audio recording, heartfelt letter, or photo. Find out more at AmericasCheer.com. Features 1996 Olympic Gold Medalist Kerri Strug.

]]> americasathletesbeijingcheergameskerriolympicsstrugsummer http://revver.com/video/806912/americas-cheer-program-supports-us-olympic-athletes/ http://revver.com/watch/806912 America's Cheer Program Supports US Olympic Athletes Bank of America has established the \"America's Cheer Program\". Support your favorite athletes - contribute a video, audio recording, heartfelt letter, or photo. Find out more at AmericasCheer.com. Features 1996 Olympic Gold Medalist Kerri Strug. Bank of America has established the \"America's Cheer Program\". Support your favorite athletes - contribute a video, audio recording, heartfelt letter, or photo. Find out more at AmericasCheer.com. Features 1996 Olympic Gold Medalist Kerri Strug. Meshmonster Meshmonster americas athletes beijing cheer games kerri olympics strug summer nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Gale Gand Restaurant Style Food Without Breaking the Bank Fri, 04 Apr 2008 13:46:17 -0800

Author: Meshmonster
Added: Fri, 04 Apr 2008 13:46:17 -0800
Duration: 62

Author and Pastry Chef Gale Gand talks about how a little smart shopping can make it easy and affordable for families to enjoy restaurant style food at home.

]]> creamdessertseasyfinefoodsgalegandreddishoppingsmartwhippedwip http://revver.com/video/790575/gale-gand-restaurant-style-food-without-breaking-the-bank/ http://revver.com/watch/790575 Gale Gand Restaurant Style Food Without Breaking the Bank Author and Pastry Chef Gale Gand talks about how a little smart shopping can make it easy and affordable for families to enjoy restaurant style food at home. Author and Pastry Chef Gale Gand talks about how a little smart shopping can make it easy and affordable for families to enjoy restaurant style food at home. Meshmonster Meshmonster cream desserts easy fine foods gale gand reddi shopping smart whipped wip nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Lenovo Auctions Notebook PC's Inspired by Olympics Thu, 27 Mar 2008 13:46:19 -0800

Author: Meshmonster
Added: Thu, 27 Mar 2008 13:46:19 -0800
Duration: 47

Lenovo is auctioning limited 2008 Olypmpics edition notebook PC's. Each week the auction will begin in a different country. US editions of the notebooks are signed by Olympic Gold Medalists Kerri Walsh and Misty May-Treanor.

]]> beijingkerrilaptopslenovomay-treanormistynotebookolympicspcwalsh http://revver.com/video/772349/lenovo-auctions-notebook-pcs-inspired-by-olympics/ http://revver.com/watch/772349 Lenovo Auctions Notebook PC's Inspired by Olympics Lenovo is auctioning limited 2008 Olypmpics edition notebook PC's. Each week the auction will begin in a different country. US editions of the notebooks are signed by Olympic Gold Medalists Kerri Walsh and Misty May-Treanor. Lenovo is auctioning limited 2008 Olypmpics edition notebook PC's. Each week the auction will begin in a different country. US editions of the notebooks are signed by Olympic Gold Medalists Kerri Walsh and Misty May-Treanor. Meshmonster Meshmonster beijing kerri laptops lenovo may-treanor misty notebook olympics pc walsh nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Samuel L. Jackson Helps Honor Memory of MLK Thu, 27 Mar 2008 12:46:17 -0800

Author: Meshmonster
Added: Thu, 27 Mar 2008 12:46:17 -0800
Duration: 83

Samuel L. Jackson and over 100 volunteers help to restore the National Civil Rights Museum, located at the spot where Dr. Martin Luther King Jr. was gunned down 40 years ago. The event was organized by the Save-A-Landmark Program.

]]> civiljacksonjr.kingl.luthermartinmuseumnationalprogramrightssamuelsave-a-landmark http://revver.com/video/772248/samuel-l-jackson-helps-honor-memory-of-mlk/ http://revver.com/watch/772248 Samuel L. Jackson Helps Honor Memory of MLK Samuel L. Jackson and over 100 volunteers help to restore the National Civil Rights Museum, located at the spot where Dr. Martin Luther King Jr. was gunned down 40 years ago. The event was organized by the Save-A-Landmark Program. Samuel L. Jackson and over 100 volunteers help to restore the National Civil Rights Museum, located at the spot where Dr. Martin Luther King Jr. was gunned down 40 years ago. The event was organized by the Save-A-Landmark Program. Meshmonster Meshmonster civil jackson jr. king l. luther martin museum national program rights samuel save-a-landmark nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Actress Judy Greer \"Be Kind to Your Behind\" Wed, 26 Mar 2008 12:46:20 -0800

Author: Meshmonster
Added: Wed, 26 Mar 2008 12:46:20 -0800
Duration: 72

Television and film star Judy Greer, joined by the iconic Cottonelle Puppy, tells how to add some much deserved comfort to the everyday and the importance of pampering this important body part. Judy is on tour with the Comfort Haven.

]]> bebehindcomfortcottonellegreerhavenhealthjudykindpuppytissuetotoiletyour http://revver.com/video/769837/actress-judy-greer-be-kind-to-your-behind/ http://revver.com/watch/769837 Actress Judy Greer \"Be Kind to Your Behind\" Television and film star Judy Greer, joined by the iconic Cottonelle Puppy, tells how to add some much deserved comfort to the everyday and the importance of pampering this important body part. Judy is on tour with the Comfort Haven. Television and film star Judy Greer, joined by the iconic Cottonelle Puppy, tells how to add some much deserved comfort to the everyday and the importance of pampering this important body part. Judy is on tour with the Comfort Haven. Meshmonster Meshmonster be behind comfort cottonelle greer haven health judy kind puppy tissue to toilet your nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Michele Ammon Puts a New Twist on Easter Wed, 19 Mar 2008 16:46:25 -0800

Author: Meshmonster
Added: Wed, 19 Mar 2008 16:46:25 -0800
Duration: 68

Michele Ammon provides new ideas your Easter holiday this year. Michele will provides healthy alternatives to the usual Easter meals and snacks for your Easter basket.

]]> ammonbasketseastereggbeaterseggsmealsmichele http://revver.com/video/755569/michele-ammon-puts-a-new-twist-on-easter/ http://revver.com/watch/755569 Michele Ammon Puts a New Twist on Easter Michele Ammon provides new ideas your Easter holiday this year. Michele will provides healthy alternatives to the usual Easter meals and snacks for your Easter basket. Michele Ammon provides new ideas your Easter holiday this year. Michele will provides healthy alternatives to the usual Easter meals and snacks for your Easter basket. Meshmonster Meshmonster ammon baskets easter eggbeaters eggs meals michele nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Air Tran Offering Non-Stop Flights to Puerto Rico Wed, 12 Mar 2008 10:46:16 -0800

Author: Meshmonster
Added: Wed, 12 Mar 2008 10:46:16 -0800
Duration: 45

AirTran Airways inaugurates new nonstop service from San Juan, Puerto Rico to Atlanta, Georgia, and Orlando, Florida, effective March 5, 2008. Welterweight World Champion Miguel Cotto will be on hand to lead an airport parade and throw the ceremonial first punch to officially begin the new service. The low fare carrier will offer a daily round-trip nonstop flight between San Juan Luis Muñoz Marin International Airport in San Juan, Puerto Rico, and Hartsfield-Jackson Atlanta International Airport in Atlanta, Ga. AirTran Airways will also offer a daily round-trip nonstop flight between San Juan and Orlando International Airport in Orlando, Fla., with a second daily nonstop flight from Orlando beginning April 9, 2008.

]]> airlinesairtranflightsmiguel cottopuerto rico http://revver.com/video/738261/air-tran-offering-non-stop-flights-to-puerto-rico/ http://revver.com/watch/738261 Air Tran Offering Non-Stop Flights to Puerto Rico AirTran Airways inaugurates new nonstop service from San Juan, Puerto Rico to Atlanta, Georgia, and Orlando, Florida, effective March 5, 2008. Welterweight World Champion Miguel Cotto will be on hand to lead an airport parade and throw the ceremonial first punch to officially begin the new service. The low fare carrier will offer a daily round-trip nonstop flight between San Juan Luis Muñoz Marin International Airport in San Juan, Puerto Rico, and Hartsfield-Jackson Atlanta International Airport in Atlanta, Ga. AirTran Airways will also offer a daily round-trip nonstop flight between San Juan and Orlando International Airport in Orlando, Fla., with a second daily nonstop flight from Orlando beginning April 9, 2008. AirTran Airways inaugurates new nonstop service from San Juan, Puerto Rico to Atlanta, Georgia, and Orlando, Florida, effective March 5, 2008. Welterweight World Champion Miguel Cotto will be on hand to lead an airport parade and throw the ceremonial first punch to officially begin the new service. The low fare carrier will offer a daily round-trip nonstop flight between San Juan Luis Muñoz Marin International Airport in San Juan, Puerto Rico, and Hartsfield-Jackson Atlanta International Airport in Atlanta, Ga. AirTran Airways will also offer a daily round-trip nonstop flight between San Juan and Orlando International Airport in Orlando, Fla., with a second daily nonstop flight from Orlando beginning April 9, 2008. AirTran Airways, Miguel Cotto AirTran Airways, Miguel Cotto airlines airtran flights miguel cotto puerto rico nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Newest Technology - Thinnest, Lightest Laptop from Lenovo Tue, 11 Mar 2008 14:46:17 -0800

Author: Meshmonster
Added: Tue, 11 Mar 2008 14:46:17 -0800
Duration: 55

The latest breakthrough in lightweight laptops is being unveiled! Finally, the thinnest, lightest notebook full function PC in its class that includes all the technologies everybody wants! Designed for the most demanding road warriors, the 13-inch widescreen ThinkPad X300 notebook from Lenovo weighs a minimum of just 2.9 pounds. And, measures just 0.73 inches at its thinnest point-about the height of a quarter!

]]> computerslaptopslenovolightlightestnewtechnologythinthinnest http://revver.com/video/736522/newest-technology-thinnest-lightest-laptop-from-lenovo/ http://revver.com/watch/736522 Newest Technology - Thinnest, Lightest Laptop from Lenovo The latest breakthrough in lightweight laptops is being unveiled! Finally, the thinnest, lightest notebook full function PC in its class that includes all the technologies everybody wants! Designed for the most demanding road warriors, the 13-inch widescreen ThinkPad X300 notebook from Lenovo weighs a minimum of just 2.9 pounds. And, measures just 0.73 inches at its thinnest point-about the height of a quarter! The latest breakthrough in lightweight laptops is being unveiled! Finally, the thinnest, lightest notebook full function PC in its class that includes all the technologies everybody wants! Designed for the most demanding road warriors, the 13-inch widescreen ThinkPad X300 notebook from Lenovo weighs a minimum of just 2.9 pounds. And, measures just 0.73 inches at its thinnest point-about the height of a quarter! Lenovo Lenovo computers laptops lenovo light lightest new technology thin thinnest nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Molly Shannon - Allergies Are No Laughing Matter Mon, 10 Mar 2008 14:16:18 -0800

Author: Meshmonster
Added: Mon, 10 Mar 2008 14:16:18 -0800
Duration: 41

The Allergy and Asthma Foundation of America and the makers of Zyrtec team up with Molly Shannon to educate allergy sufferers about how to manage allergies better.

]]> allergiesallergy and asthma foundation educationmolly shannonzyrtec http://revver.com/video/733934/molly-shannon-allergies-are-no-laughing-matter/ http://revver.com/watch/733934 Molly Shannon - Allergies Are No Laughing Matter The Allergy and Asthma Foundation of America and the makers of Zyrtec team up with Molly Shannon to educate allergy sufferers about how to manage allergies better. The Allergy and Asthma Foundation of America and the makers of Zyrtec team up with Molly Shannon to educate allergy sufferers about how to manage allergies better. Molly Shannon, The Allergy and Asthma Foundation of America Molly Shannon, The Allergy and Asthma Foundation of America allergies allergy and asthma foundation education molly shannon zyrtec nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Chef Rocco DiSpirito Recipe for Romance Fri, 07 Mar 2008 10:16:19 -0800

Author: Meshmonster
Added: Fri, 07 Mar 2008 10:16:19 -0800
Duration: 52

According to a recent survey, American couples confess they are not spending enough time together; with almost 75% wishing they had more time to spend with their significant other. Rocco wants to inspire couples to get cooking as he believes “Making a meal for someone you love is the most generous thing you can do for them and the best way to reconnect.” Rocco is launching a new contest with Bertolli called “Dinner and Your Movie”. He will ask viewers about their ingredients for a romantic night in and tell them how they could get their story filmed for the big screen, plus how they could get full star treatment for the making of their movie and the premiere.

]]> cookingcouplesdiningdinnerfoodrocco dispiritoromace http://revver.com/video/727800/chef-rocco-dispirito-recipe-for-romance/ http://revver.com/watch/727800 Chef Rocco DiSpirito Recipe for Romance According to a recent survey, American couples confess they are not spending enough time together; with almost 75% wishing they had more time to spend with their significant other. Rocco wants to inspire couples to get cooking as he believes “Making a meal for someone you love is the most generous thing you can do for them and the best way to reconnect.” Rocco is launching a new contest with Bertolli called “Dinner and Your Movie”. He will ask viewers about their ingredients for a romantic night in and tell them how they could get their story filmed for the big screen, plus how they could get full star treatment for the making of their movie and the premiere. According to a recent survey, American couples confess they are not spending enough time together; with almost 75% wishing they had more time to spend with their significant other. Rocco wants to inspire couples to get cooking as he believes “Making a meal for someone you love is the most generous thing you can do for them and the best way to reconnect.” Rocco is launching a new contest with Bertolli called “Dinner and Your Movie”. He will ask viewers about their ingredients for a romantic night in and tell them how they could get their story filmed for the big screen, plus how they could get full star treatment for the making of their movie and the premiere. Bertolli, Rocco DiSpirito Bertolli, Rocco DiSpirito cooking couples dining dinner food rocco dispirito romace nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Cal Ripken's Real Baseball Tue, 04 Mar 2008 15:16:18 -0800

Author: Meshmonster
Added: Tue, 04 Mar 2008 15:16:18 -0800
Duration: 47

Cal Ripken’s Real Baseball delivers a first-person perspective of a character, created and developed by the player, interacting online in real-time with teammates and opponents. Each position on the field is manned by a human player in a 3-D virtual stadium. Players can create their own characters and build their skill level (player stats) through successful play on the field against other real human players. Courtesy of Real Baseball.

]]> baseballcal ripkencal ripkens real baseballonlinereal baseballvideo games http://revver.com/video/720648/cal-ripkens-real-baseball/ http://revver.com/watch/720648 Cal Ripken's Real Baseball Cal Ripken’s Real Baseball delivers a first-person perspective of a character, created and developed by the player, interacting online in real-time with teammates and opponents. Each position on the field is manned by a human player in a 3-D virtual stadium. Players can create their own characters and build their skill level (player stats) through successful play on the field against other real human players. Courtesy of Real Baseball. Cal Ripken’s Real Baseball delivers a first-person perspective of a character, created and developed by the player, interacting online in real-time with teammates and opponents. Each position on the field is manned by a human player in a 3-D virtual stadium. Players can create their own characters and build their skill level (player stats) through successful play on the field against other real human players. Courtesy of Real Baseball. Real Baseball Real Baseball baseball cal ripken cal ripkens real baseball online real baseball video games nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Dr. Christine Dumas on simple techniques to break free of weight-loss plateau Tue, 04 Mar 2008 15:16:18 -0800

Author: Meshmonster
Added: Tue, 04 Mar 2008 15:16:18 -0800
Duration: 46

You know you’ve hit a plateau when more than two weeks have gone by without any drop in your weight and no loss of inches. While it may seem frustrating, experts say it is common; and happens to anybody who’s been on the same diet and exercise plan for awhile. Dr. Christine Dumas, Weight Management Expert and author of “The Most Wanted Life,” has the secret weapons to win your private diet war. Courtesy of Kellogg's.

]]> dietdietingexerciselosing weightplateauweight loss http://revver.com/video/720679/dr-christine-dumas-on-simple-techniques-to-break-free-of-weight-loss-plateau/ http://revver.com/watch/720679 Dr. Christine Dumas on simple techniques to break free of weight-loss plateau You know you’ve hit a plateau when more than two weeks have gone by without any drop in your weight and no loss of inches. While it may seem frustrating, experts say it is common; and happens to anybody who’s been on the same diet and exercise plan for awhile. Dr. Christine Dumas, Weight Management Expert and author of “The Most Wanted Life,” has the secret weapons to win your private diet war. Courtesy of Kellogg's. You know you’ve hit a plateau when more than two weeks have gone by without any drop in your weight and no loss of inches. While it may seem frustrating, experts say it is common; and happens to anybody who’s been on the same diet and exercise plan for awhile. Dr. Christine Dumas, Weight Management Expert and author of “The Most Wanted Life,” has the secret weapons to win your private diet war. Courtesy of Kellogg's. Dr. Christine Dumas, Kellogg's Dr. Christine Dumas, Kellogg's diet dieting exercise losing weight plateau weight loss nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Charlotte Reed Gives Tips on "PET-IQUETTE" (Pet etiquette) for dog and cat owners Wed, 27 Feb 2008 13:16:19 -0800

Author: Meshmonster
Added: Wed, 27 Feb 2008 13:16:19 -0800
Duration: 221

Pet expert Charlotte Reed, author the of Miss Fido Manners colomn, which is published in Fido Friendly magazine, discusses pet etiquette, including the best ways to keep your pet calm and respectful when in public, or when you have people in your home or when traveling on business or vacation. She will show you the latest innovations that can help you keep your animal and your surroundings a place people actually want to visit.

]]> calmcarecatscharlotte reedcleaningdogsetiquettemannersmiss fido mannerstraveling http://revver.com/video/707417/charlotte-reed-gives-tips-on-pet-iquette-pet-etiquette-for-dog-and-cat-owners/ http://revver.com/watch/707417 Charlotte Reed Gives Tips on "PET-IQUETTE" (Pet etiquette) for dog and cat owners Pet expert Charlotte Reed, author the of Miss Fido Manners colomn, which is published in Fido Friendly magazine, discusses pet etiquette, including the best ways to keep your pet calm and respectful when in public, or when you have people in your home or when traveling on business or vacation. She will show you the latest innovations that can help you keep your animal and your surroundings a place people actually want to visit. Pet expert Charlotte Reed, author the of Miss Fido Manners colomn, which is published in Fido Friendly magazine, discusses pet etiquette, including the best ways to keep your pet calm and respectful when in public, or when you have people in your home or when traveling on business or vacation. She will show you the latest innovations that can help you keep your animal and your surroundings a place people actually want to visit. Charlotte Reed Charlotte Reed calm care cats charlotte reed cleaning dogs etiquette manners miss fido manners traveling nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mike Ferrara and Gale Steves Live from International Builders Show 2007 Wed, 20 Feb 2008 14:46:19 -0800

Author: Meshmonster
Added: Wed, 20 Feb 2008 14:46:19 -0800
Duration: 319

"Design Diva", Gale Steves is a former Editor-In-Chief of Home Magazine and a consultant to leading home improvement companies. "Lazy Homeowner, a.k.a TechnoDad" Mike Ferrara, is a former newspaper reporter and editor who has worked for a number of leading consumer magazines. The two will talk about the best ways to improve your home, coinciding with the Builders' Show in Orlando.

]]> 2007 builders showgale steveshome improvementhome magazinemike ferrararemodeling tipsthe lazy homeowner http://revver.com/video/693290/mike-ferrara-and-gale-steves-live-from-international-builders-show-2007/ http://revver.com/watch/693290 Mike Ferrara and Gale Steves Live from International Builders Show 2007 "Design Diva", Gale Steves is a former Editor-In-Chief of Home Magazine and a consultant to leading home improvement companies. "Lazy Homeowner, a.k.a TechnoDad" Mike Ferrara, is a former newspaper reporter and editor who has worked for a number of leading consumer magazines. The two will talk about the best ways to improve your home, coinciding with the Builders' Show in Orlando. "Design Diva", Gale Steves is a former Editor-In-Chief of Home Magazine and a consultant to leading home improvement companies. "Lazy Homeowner, a.k.a TechnoDad" Mike Ferrara, is a former newspaper reporter and editor who has worked for a number of leading consumer magazines. The two will talk about the best ways to improve your home, coinciding with the Builders' Show in Orlando. Gale Steves, Mike Ferrara Gale Steves, Mike Ferrara 2007 builders show gale steves home improvement home magazine mike ferrara remodeling tips the lazy homeowner nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Environmental Education Exhibition Lets Children Explore Trees Inside and Out Mon, 18 Feb 2008 15:16:21 -0800

Author: Meshmonster
Added: Mon, 18 Feb 2008 15:16:21 -0800
Duration: 60

This traveling exhibition presented by Doubletree Hotels and developed by The Arbor Day Foundation and the Dimensions Educational Research Foundation, is a three year project that allows children to explore trees inside and out. They can walk through the trunk of the tree, discover the magic of photosynthesis, examine the veins of leaves, and much more. The exhibition will be on display at children's museums and science centers through 2010.

]]> childreneducationenvironmentenvironmental educationexhibitsgreentrees http://revver.com/video/688863/environmental-education-exhibition-lets-children-explore-trees-inside-and-out/ http://revver.com/watch/688863 Environmental Education Exhibition Lets Children Explore Trees Inside and Out This traveling exhibition presented by Doubletree Hotels and developed by The Arbor Day Foundation and the Dimensions Educational Research Foundation, is a three year project that allows children to explore trees inside and out. They can walk through the trunk of the tree, discover the magic of photosynthesis, examine the veins of leaves, and much more. The exhibition will be on display at children's museums and science centers through 2010. This traveling exhibition presented by Doubletree Hotels and developed by The Arbor Day Foundation and the Dimensions Educational Research Foundation, is a three year project that allows children to explore trees inside and out. They can walk through the trunk of the tree, discover the magic of photosynthesis, examine the veins of leaves, and much more. The exhibition will be on display at children's museums and science centers through 2010. Doubletree Hotels, Dimensions Educational Research Foundation, Arbor Day Foundation Doubletree Hotels, Dimensions Educational Research Foundation, Arbor Day Foundation children education environment environmental education exhibits green trees nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ 1st ever wedding at 100th Chicago Auto Show Fri, 15 Feb 2008 11:16:20 -0800

Author: Meshmonster
Added: Fri, 15 Feb 2008 11:16:20 -0800
Duration: 43

Blake and Jackie Rohner were the lucky winners of the Dodge "Journey of a Lifetime" contest. Winnings included an all-expense-paid wedding at the 100th Chicago Auto Show and a new Dodge!

]]> chicago auto showdodgejourney of a lifetimeweddingweddings http://revver.com/video/683181/1st-ever-wedding-at-100th-chicago-auto-show/ http://revver.com/watch/683181 1st ever wedding at 100th Chicago Auto Show Blake and Jackie Rohner were the lucky winners of the Dodge "Journey of a Lifetime" contest. Winnings included an all-expense-paid wedding at the 100th Chicago Auto Show and a new Dodge! Blake and Jackie Rohner were the lucky winners of the Dodge "Journey of a Lifetime" contest. Winnings included an all-expense-paid wedding at the 100th Chicago Auto Show and a new Dodge! Dodge, KEF Media Dodge, KEF Media chicago auto show dodge journey of a lifetime wedding weddings nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Coca-Cola's new ad featuring James Carville and Bill Frist Tue, 05 Feb 2008 09:46:20 -0800

Author: Meshmonster
Added: Tue, 05 Feb 2008 09:46:20 -0800
Duration: 219

As campaign season kicks into high gear, the world’s number one sparkling beverage, Coca-Cola, is packing a double punch. With the presidential primaries in full swing, one timely ad features recognizable political opponents, James Carville and Bill Frist, who put aside their disagreements as they share a Coca-Cola.

]]> bill fristcoca-colademocratsjames carvllerepublicanssuperbowl http://revver.com/video/658446/coca-colas-new-ad-featuring-james-carville-and-bill-frist/ http://revver.com/watch/658446 Coca-Cola's new ad featuring James Carville and Bill Frist As campaign season kicks into high gear, the world’s number one sparkling beverage, Coca-Cola, is packing a double punch. With the presidential primaries in full swing, one timely ad features recognizable political opponents, James Carville and Bill Frist, who put aside their disagreements as they share a Coca-Cola. As campaign season kicks into high gear, the world’s number one sparkling beverage, Coca-Cola, is packing a double punch. With the presidential primaries in full swing, one timely ad features recognizable political opponents, James Carville and Bill Frist, who put aside their disagreements as they share a Coca-Cola. James Carville, Bill Frist, Coca-Cola James Carville, Bill Frist, Coca-Cola bill frist coca-cola democrats james carvlle republicans superbowl nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Brett Favre & Fred Taylor at Phoenix Children's Hospital Mon, 04 Feb 2008 07:46:21 -0800

Author: Meshmonster
Added: Mon, 04 Feb 2008 07:46:21 -0800
Duration: 34

The competition between the best players in the league is hitting a climax before the Big Game begins as the consumers' choice for the FedEx Air and Ground players of the year are announced. As part of Super Bowl week, award winners', Brett Favre and Fred Taylor paid a visit to the Phoenix Children's Hospital. During the visit, the hospital received a check for $25,000 in the names of each of the winning players from FedEx as part of their partnership with the NFL. The players spent time visiting with the children, signing autographs, and even tossing the ball around. As the hype of the game ramps up, it's always nice to see the NFL's best taking time out to visit and brighten the day of some very deserving children.

]]> brett favre fred taylor footba http://revver.com/video/656211/brett-favre-fred-taylor-at-phoenix-childrens-hospital/ http://revver.com/watch/656211 Brett Favre & Fred Taylor at Phoenix Children's Hospital The competition between the best players in the league is hitting a climax before the Big Game begins as the consumers' choice for the FedEx Air and Ground players of the year are announced. As part of Super Bowl week, award winners', Brett Favre and Fred Taylor paid a visit to the Phoenix Children's Hospital. During the visit, the hospital received a check for $25,000 in the names of each of the winning players from FedEx as part of their partnership with the NFL. The players spent time visiting with the children, signing autographs, and even tossing the ball around. As the hype of the game ramps up, it's always nice to see the NFL's best taking time out to visit and brighten the day of some very deserving children. The competition between the best players in the league is hitting a climax before the Big Game begins as the consumers' choice for the FedEx Air and Ground players of the year are announced. As part of Super Bowl week, award winners', Brett Favre and Fred Taylor paid a visit to the Phoenix Children's Hospital. During the visit, the hospital received a check for $25,000 in the names of each of the winning players from FedEx as part of their partnership with the NFL. The players spent time visiting with the children, signing autographs, and even tossing the ball around. As the hype of the game ramps up, it's always nice to see the NFL's best taking time out to visit and brighten the day of some very deserving children. FedEx, Brett Favre, Fred Taylor FedEx, Brett Favre, Fred Taylor brett favre fred taylor footba nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Dallas Cowboys Cheerleaders Thu, 24 Jan 2008 11:52:59 -0800

Author: Meshmonster
Added: Thu, 24 Jan 2008 11:52:59 -0800
Duration: 115

Dallas Cowboy Cheerleaders in Roto Rooters "Pimped Out Powder Room". This is every woman's fantasy powder room. Visit www.rotorooter.com to enter to win a "Pimped Out Powder Room".

]]> cheerleaderscontestcontestsdallas cowboys cheerleaderssexy http://revver.com/video/634874/dallas-cowboys-cheerleaders/ http://revver.com/watch/634874 Dallas Cowboys Cheerleaders Dallas Cowboy Cheerleaders in Roto Rooters "Pimped Out Powder Room". This is every woman's fantasy powder room. Visit www.rotorooter.com to enter to win a "Pimped Out Powder Room". Dallas Cowboy Cheerleaders in Roto Rooters "Pimped Out Powder Room". This is every woman's fantasy powder room. Visit www.rotorooter.com to enter to win a "Pimped Out Powder Room". Roto Rooter, Dallas Cowboys Cheerleaders, KEF Media Associaties Roto Rooter, Dallas Cowboys Cheerleaders, KEF Media Associaties cheerleaders contest contests dallas cowboys cheerleaders sexy nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Room A Day Contest For Mothers Who Work From Home Tue, 22 Jan 2008 10:38:37 -0800

Author: Meshmonster
Added: Tue, 22 Jan 2008 10:38:37 -0800
Duration: 36

Mothers who work from home can enter a contest to win a home office makeover at www.roomadaygiveaway.com. Video features author Stacy Debroff.

]]> home officehome officesmothers who work from homestacy debroffworking from home http://revver.com/video/630950/room-a-day-contest-for-mothers-who-work-from-home/ http://revver.com/watch/630950 Room A Day Contest For Mothers Who Work From Home Mothers who work from home can enter a contest to win a home office makeover at www.roomadaygiveaway.com. Video features author Stacy Debroff. Mothers who work from home can enter a contest to win a home office makeover at www.roomadaygiveaway.com. Video features author Stacy Debroff. KEF Media, Kimberly Clark, Stacy DeBroff KEF Media, Kimberly Clark, Stacy DeBroff home office home offices mothers who work from home stacy debroff working from home nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Victoria Moran, Author of "Fat Broke and Lonely No More" Offers Tips to Get Your Life in Order in 2008 Sat, 29 Dec 2007 10:00:20 -0800

Author: Meshmonster
Added: Sat, 29 Dec 2007 10:00:20 -0800
Duration: 125

Victoria Moran, Author of "Fat Broke and Lonely No More" Offers Tips to Get Your Life in Order in 2008. How to keep New Year's Resolutions. How to get a handle on your finances.

]]> advicefinanceskeeping resolutionsnew years resolutionsvictoria moran http://revver.com/video/589897/victoria-moran-author-of-fat-broke-and-lonely-no-more-offers-tips-to-get-your-life-in-order-in-2008/ http://revver.com/watch/589897 Victoria Moran, Author of "Fat Broke and Lonely No More" Offers Tips to Get Your Life in Order in 2008 Victoria Moran, Author of "Fat Broke and Lonely No More" Offers Tips to Get Your Life in Order in 2008. How to keep New Year's Resolutions. How to get a handle on your finances. Victoria Moran, Author of "Fat Broke and Lonely No More" Offers Tips to Get Your Life in Order in 2008. How to keep New Year's Resolutions. How to get a handle on your finances. KEF Media KEF Media advice finances keeping resolutions new years resolutions victoria moran nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Shopping Expert Michele Ammon Gives Advice to Last Minute Shoppers Tue, 18 Dec 2007 15:28:08 -0800

Author: Meshmonster
Added: Tue, 18 Dec 2007 15:28:08 -0800
Duration: 258

Shopping Expert Michele Ammon Gives Advice to those Last Minute Shoppers Desparate for Christmas Gift Ideas.

]]> christmas shoppinggift ideaslast minute shopping http://revver.com/video/574314/shopping-expert-michele-ammon-gives-advice-to-last-minute-shoppers/ http://revver.com/watch/574314 Shopping Expert Michele Ammon Gives Advice to Last Minute Shoppers Shopping Expert Michele Ammon Gives Advice to those Last Minute Shoppers Desparate for Christmas Gift Ideas. Shopping Expert Michele Ammon Gives Advice to those Last Minute Shoppers Desparate for Christmas Gift Ideas. Meshmonster Meshmonster christmas shopping gift ideas last minute shopping nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Expert Shopper Michele Ammon on Christmas Gift Ideas for Last Minute Shoppers Tue, 18 Dec 2007 15:28:08 -0800

Author: Meshmonster
Added: Tue, 18 Dec 2007 15:28:08 -0800
Duration: 258

Expert Shopper Michele Ammon on Christmas Gift Ideas for Last Minute Shoppers

]]> christmas gift shoppingchristmas giftschristmas shoppinggift ideaslast minute shopping http://revver.com/video/574610/expert-shopper-michele-ammon-on-christmas-gift-ideas-for-last-minute-shoppers/ http://revver.com/watch/574610 Expert Shopper Michele Ammon on Christmas Gift Ideas for Last Minute Shoppers Expert Shopper Michele Ammon on Christmas Gift Ideas for Last Minute Shoppers Expert Shopper Michele Ammon on Christmas Gift Ideas for Last Minute Shoppers Michele Ammon Michele Ammon christmas gift shopping christmas gifts christmas shopping gift ideas last minute shopping nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Cyber Monday and Shopping Online for the Holidays Tue, 27 Nov 2007 15:19:06 -0800

Author: Meshmonster
Added: Tue, 27 Nov 2007 15:19:06 -0800
Duration: 296

Information about Cyber monday, gift ideas, and what is selling well this year.

]]> christmas shoppingcyber mondayfinding gifts onlineholiday shoppingonline shopping http://revver.com/video/501331/cyber-monday-and-shopping-online-for-the-holidays/ http://revver.com/watch/501331 Cyber Monday and Shopping Online for the Holidays Information about Cyber monday, gift ideas, and what is selling well this year. Information about Cyber monday, gift ideas, and what is selling well this year. Kef Media Kef Media christmas shopping cyber monday finding gifts online holiday shopping online shopping nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/