Videos by ScienCentral Videos by ScienCentral http://revver.com/u/ScienCentral/ http://revver.com webmaster@revver.com Baby Scent and Dads Mon, 27 Oct 2008 18:55:11 -0800

Author: ScienCentral
Added: Mon, 27 Oct 2008 18:55:11 -0800
Duration: 107

tbd

]]> tbd http://revver.com/video/1282713/baby-scent-and-dads/ http://revver.com/watch/1282713 Baby Scent and Dads tbd tbd ScienCentral ScienCentral tbd nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Video Games and Biology Thu, 23 Oct 2008 20:33:57 -0800

Author: ScienCentral
Added: Thu, 23 Oct 2008 20:33:57 -0800
Duration: 96

Video games aren't just for kids. Researchers are now using the same technology that runs games to create realistic simulations of biological systems. As ScienCentral News reports, this approach could speed up research into diseases and drug therapies.

]]> animationbacteriacat2010electronic artsgraphics cardinfectionmichigan technological universscience articlesscience videossciencentralsporetuberculosisvideo gamesviruses http://revver.com/video/1274755/video-games-and-biology/ http://revver.com/watch/1274755 Video Games and Biology Video games aren't just for kids. Researchers are now using the same technology that runs games to create realistic simulations of biological systems. As ScienCentral News reports, this approach could speed up research into diseases and drug therapies. Video games aren't just for kids. Researchers are now using the same technology that runs games to create realistic simulations of biological systems. As ScienCentral News reports, this approach could speed up research into diseases and drug therapies. ScienCentral ScienCentral animation bacteria cat2010 electronic arts graphics card infection michigan technological univers science articles science videos sciencentral spore tuberculosis video games viruses nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Inherited Obesity Thu, 23 Oct 2008 14:54:42 -0800

Author: ScienCentral
Added: Thu, 23 Oct 2008 14:54:42 -0800
Duration: 117

If you're planning to have children and want to help them avoid getting fat, lose your own fat before you get pregnant. That's the message from researchers who have found obesity during pregnancy can cause lifelong obesity in the next generations. As this ScienCentral News video explains, the good news is that researchers also found a dietary way to reverse this effect.

]]> dietfatfolic acidgenerationsinheritednutritionobesitypregnancy http://revver.com/video/1274467/inherited-obesity/ http://revver.com/watch/1274467 Inherited Obesity If you're planning to have children and want to help them avoid getting fat, lose your own fat before you get pregnant. That's the message from researchers who have found obesity during pregnancy can cause lifelong obesity in the next generations. As this ScienCentral News video explains, the good news is that researchers also found a dietary way to reverse this effect. If you're planning to have children and want to help them avoid getting fat, lose your own fat before you get pregnant. That's the message from researchers who have found obesity during pregnancy can cause lifelong obesity in the next generations. As this ScienCentral News video explains, the good news is that researchers also found a dietary way to reverse this effect. ScienCentral ScienCentral diet fat folic acid generations inherited nutrition obesity pregnancy nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Fly Swat Science Wed, 22 Oct 2008 17:33:48 -0800

Author: ScienCentral
Added: Wed, 22 Oct 2008 17:33:48 -0800
Duration: 116

WHY ARE FLIES SO HARD TO SWAT? IT TOOK THE WORLD'S TOP FLY RESEARCHERS AT CALTECH TO GIVE US THE ANSWER. SUNITA REED REPORTS ON A FINDING THAT WILL GIVE YOU POINTERS the NEXT TIME YOU SWING YOUR SWATTER.

]]> caltechcat1930dickinson labflightflyfruit flyscience articlesscience storiesscience videosswatter http://revver.com/video/1269285/fly-swat-science/ http://revver.com/watch/1269285 Fly Swat Science WHY ARE FLIES SO HARD TO SWAT? IT TOOK THE WORLD'S TOP FLY RESEARCHERS AT CALTECH TO GIVE US THE ANSWER. SUNITA REED REPORTS ON A FINDING THAT WILL GIVE YOU POINTERS the NEXT TIME YOU SWING YOUR SWATTER. WHY ARE FLIES SO HARD TO SWAT? IT TOOK THE WORLD'S TOP FLY RESEARCHERS AT CALTECH TO GIVE US THE ANSWER. SUNITA REED REPORTS ON A FINDING THAT WILL GIVE YOU POINTERS the NEXT TIME YOU SWING YOUR SWATTER. ScienCentral ScienCentral caltech cat1930 dickinson lab flight fly fruit fly science articles science stories science videos swatter nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Smart Appliances Sat, 18 Oct 2008 07:54:12 -0800

Author: ScienCentral
Added: Sat, 18 Oct 2008 07:54:12 -0800
Duration: 105

Coming to a house or apartment near you, "Smart Appliances". As this ScienCentral News video explains, researchers are getting appliances to work together to reduce electrical demand, and avoid blackouts.

]]> appliancesblackoutbrownoutcat1990electrical power gridelectricity gridgridwisepacific northwestpnnlpower outagesmart appliances http://revver.com/video/1252338/smart-appliances/ http://revver.com/watch/1252338 Smart Appliances Coming to a house or apartment near you, "Smart Appliances". As this ScienCentral News video explains, researchers are getting appliances to work together to reduce electrical demand, and avoid blackouts. Coming to a house or apartment near you, "Smart Appliances". As this ScienCentral News video explains, researchers are getting appliances to work together to reduce electrical demand, and avoid blackouts. ScienCentral ScienCentral appliances blackout brownout cat1990 electrical power grid electricity grid gridwise pacific northwest pnnl power outage smart appliances nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Highlighting Cancer Cells Tue, 14 Oct 2008 16:34:41 -0800

Author: ScienCentral
Added: Tue, 14 Oct 2008 16:34:41 -0800
Duration: 115

Cancer surgery is tricky because you don't want to miss any cancer, but you also don't want to cut healthy tissue. Now doctors are testing a new technique that uses a safe chemical highlighter, allowing surgeons to cut by color.

]]> annals of surgical oncologybeth israel deaconess medical breast cancer treatmentcancercat1840chemical highlighterchestjohn frangionilymph node biopsynear infrared lightnir fluorophoresradioactive materialsurgery http://revver.com/video/1243989/highlighting-cancer-cells/ http://revver.com/watch/1243989 Highlighting Cancer Cells Cancer surgery is tricky because you don't want to miss any cancer, but you also don't want to cut healthy tissue. Now doctors are testing a new technique that uses a safe chemical highlighter, allowing surgeons to cut by color. Cancer surgery is tricky because you don't want to miss any cancer, but you also don't want to cut healthy tissue. Now doctors are testing a new technique that uses a safe chemical highlighter, allowing surgeons to cut by color. ScienCentral ScienCentral annals of surgical oncology beth israel deaconess medical breast cancer treatment cancer cat1840 chemical highlighter chest john frangioni lymph node biopsy near infrared light nir fluorophores radioactive material surgery nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Addicted Brain Changes Sat, 11 Oct 2008 12:34:18 -0800

Author: ScienCentral
Added: Sat, 11 Oct 2008 12:34:18 -0800
Duration: 115

New research is overturning previous thoughts about how addiction changes the brain. Researchers hope these insights will lead to new ways of treating addicts.

]]> addictionbraincat2000christopher cowandendritic spinesmef2neuronnucleus accumbenssynapsesuniversity of texas southweste http://revver.com/video/1233131/addicted-brain-changes/ http://revver.com/watch/1233131 Addicted Brain Changes New research is overturning previous thoughts about how addiction changes the brain. Researchers hope these insights will lead to new ways of treating addicts. New research is overturning previous thoughts about how addiction changes the brain. Researchers hope these insights will lead to new ways of treating addicts. ScienCentral ScienCentral addiction brain cat2000 christopher cowan dendritic spines mef2 neuron nucleus accumbens synapses university of texas southweste nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Cancer Killing Viruses Thu, 09 Oct 2008 12:34:09 -0800

Author: ScienCentral
Added: Thu, 09 Oct 2008 12:34:09 -0800
Duration: 125

Scientists at the Center for Gene Therapy have developed glowing viruses.

]]> cancercenter for gene therapygenetic engineeringglowing genesglowing viruseshuman trialsneuro-therapyscientific americantumorsviruses http://revver.com/video/1232259/cancer-killing-viruses/ http://revver.com/watch/1232259 Cancer Killing Viruses Scientists at the Center for Gene Therapy have developed glowing viruses. Scientists at the Center for Gene Therapy have developed glowing viruses. ScienCentral ScienCentral cancer center for gene therapy genetic engineering glowing genes glowing viruses human trials neuro-therapy scientific american tumors viruses nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Growing Nerve Cells Thu, 09 Oct 2008 12:34:09 -0800

Author: ScienCentral
Added: Thu, 09 Oct 2008 12:34:09 -0800
Duration: 109

Scientist at AntiCancer Inc. developed and injected stem cells into brain cells and nerve cells that carried a glowing gene.

]]> anticancer inc. neuronsbrain cellsglowing geneglowing mousenerve cellsstem cells http://revver.com/video/1232278/growing-nerve-cells/ http://revver.com/watch/1232278 Growing Nerve Cells Scientist at AntiCancer Inc. developed and injected stem cells into brain cells and nerve cells that carried a glowing gene. Scientist at AntiCancer Inc. developed and injected stem cells into brain cells and nerve cells that carried a glowing gene. ScienCentral ScienCentral anticancer inc. neurons brain cells glowing gene glowing mouse nerve cells stem cells nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Hot Chili Secret Thu, 09 Oct 2008 02:53:19 -0800

Author: ScienCentral
Added: Thu, 09 Oct 2008 02:53:19 -0800
Duration: 110

Chili peppers can add a little spice to your dish, but where does that heat come from? As ScienCentral News reports, it's a rare case where we can be thankful for bugs and a fungus.

]]> chili pepper jalapeno spicy http://revver.com/video/1213979/hot-chili-secret/ http://revver.com/watch/1213979 Hot Chili Secret Chili peppers can add a little spice to your dish, but where does that heat come from? As ScienCentral News reports, it's a rare case where we can be thankful for bugs and a fungus. Chili peppers can add a little spice to your dish, but where does that heat come from? As ScienCentral News reports, it's a rare case where we can be thankful for bugs and a fungus. ScienCentral ScienCentral chili pepper jalapeno spicy nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Weight Loss Surgery Cuts Cancer Wed, 08 Oct 2008 18:53:17 -0800

Author: ScienCentral
Added: Wed, 08 Oct 2008 18:53:17 -0800
Duration: 110

It's already known that weight-loss surgery for morbid obesity can reduce the risk of diabetes and heart problems. Now, new research shows that it may also cut a person’s risk of cancer by 80-percent.

]]> bariatric surgerycancercat1920diabetesdr. nicolas christougastric bypass surgerymcgill university health centrmorbid obesityweight-loss surgery http://revver.com/video/1230643/weight-loss-surgery-cuts-cancer/ http://revver.com/watch/1230643 Weight Loss Surgery Cuts Cancer It's already known that weight-loss surgery for morbid obesity can reduce the risk of diabetes and heart problems. Now, new research shows that it may also cut a person’s risk of cancer by 80-percent. It's already known that weight-loss surgery for morbid obesity can reduce the risk of diabetes and heart problems. Now, new research shows that it may also cut a person’s risk of cancer by 80-percent. ScienCentral ScienCentral bariatric surgery cancer cat1920 diabetes dr. nicolas christou gastric bypass surgery mcgill university health centr morbid obesity weight-loss surgery nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Stillbirth Law Wed, 08 Oct 2008 06:53:18 -0800

Author: ScienCentral
Added: Wed, 08 Oct 2008 06:53:18 -0800
Duration: 105

October is National Pregnancy and Infant Loss Awareness Month, in recognition of families who lost babies to miscarriage or stillbirth. But this year, the somber nationwide gatherings marking the occasion are also filled with hope– for new legislation that could go a long way toward preventing these tragedies. This ScienCentral News video explains.

]]> babymiscarriagemissing angels billsparentspregnancyruth frettssidsstillbirth http://revver.com/video/1225582/stillbirth-law/ http://revver.com/watch/1225582 Stillbirth Law October is National Pregnancy and Infant Loss Awareness Month, in recognition of families who lost babies to miscarriage or stillbirth. But this year, the somber nationwide gatherings marking the occasion are also filled with hope– for new legislation that could go a long way toward preventing these tragedies. This ScienCentral News video explains. October is National Pregnancy and Infant Loss Awareness Month, in recognition of families who lost babies to miscarriage or stillbirth. But this year, the somber nationwide gatherings marking the occasion are also filled with hope– for new legislation that could go a long way toward preventing these tragedies. This ScienCentral News video explains. ScienCentral ScienCentral baby miscarriage missing angels bills parents pregnancy ruth fretts sids stillbirth nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Tongue Joystick Fri, 03 Oct 2008 10:52:48 -0800

Author: ScienCentral
Added: Fri, 03 Oct 2008 10:52:48 -0800
Duration: 96

Imagine changing channels or surfing the web with just a flick of your tongue. Researchers have come up with such a device. As this ScienCentral News video shows, it’s for those who are paralyzed that the system holds the most promise.

]]> alternative input devicejoystickmouseparalyzedpowerized wheelchairtongue http://revver.com/video/1214691/tongue-joystick/ http://revver.com/watch/1214691 Tongue Joystick Imagine changing channels or surfing the web with just a flick of your tongue. Researchers have come up with such a device. As this ScienCentral News video shows, it’s for those who are paralyzed that the system holds the most promise. Imagine changing channels or surfing the web with just a flick of your tongue. Researchers have come up with such a device. As this ScienCentral News video shows, it’s for those who are paralyzed that the system holds the most promise. ScienCentral ScienCentral alternative input device joystick mouse paralyzed powerized wheelchair tongue nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Faster Sea Rise Tue, 30 Sep 2008 16:33:20 -0800

Author: ScienCentral
Added: Tue, 30 Sep 2008 16:33:20 -0800
Duration: 115

A new study indicates that sea level rise due to global warming could double or triple what climate forecasters have previously predicted for the end of this century.

]]> arctic greenlandclimate forecastglobal warmingmelting glacierspolar bearsrising seas http://revver.com/video/1210559/faster-sea-rise/ http://revver.com/watch/1210559 Faster Sea Rise A new study indicates that sea level rise due to global warming could double or triple what climate forecasters have previously predicted for the end of this century. A new study indicates that sea level rise due to global warming could double or triple what climate forecasters have previously predicted for the end of this century. ScienCentral ScienCentral arctic greenland climate forecast global warming melting glaciers polar bears rising seas nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Vote for You! Fri, 26 Sep 2008 16:33:56 -0800

Author: ScienCentral
Added: Fri, 26 Sep 2008 16:33:56 -0800
Duration: 175

Researchers have shown that voters can be swayed toward choosing a candidate by making the candidate look more like the voter. As ScienCentral News reports, the visual manipulations were unnoticed, but enough to swing a presidential election.

]]> barack obamabushelectiongenderimagemccainmorphpresidential campaignracevotevoters http://revver.com/video/1201604/vote-for-you/ http://revver.com/watch/1201604 Vote for You! Researchers have shown that voters can be swayed toward choosing a candidate by making the candidate look more like the voter. As ScienCentral News reports, the visual manipulations were unnoticed, but enough to swing a presidential election. Researchers have shown that voters can be swayed toward choosing a candidate by making the candidate look more like the voter. As ScienCentral News reports, the visual manipulations were unnoticed, but enough to swing a presidential election. ScienCentral ScienCentral barack obama bush election gender image mccain morph presidential campaign race vote voters nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Baby Talk and Brain Waves Fri, 26 Sep 2008 12:46:58 -0800

Author: ScienCentral
Added: Fri, 26 Sep 2008 12:46:58 -0800
Duration: 112

Researchers studying the brains of toddlers say the strength of their brainwaves can indicate language ability. As ScienCentral reports, this research might lead to early identification of language impairment.

]]> april benasichbaby brain talkbehavioural brain researchcat1860cognitive electroencephalogramcommunicationeeggamma wavegary marcuslanguageneurosciencepsychologyrutgerstoddler waves http://revver.com/video/1202903/baby-talk-and-brain-waves/ http://revver.com/watch/1202903 Baby Talk and Brain Waves Researchers studying the brains of toddlers say the strength of their brainwaves can indicate language ability. As ScienCentral reports, this research might lead to early identification of language impairment. Researchers studying the brains of toddlers say the strength of their brainwaves can indicate language ability. As ScienCentral reports, this research might lead to early identification of language impairment. ScienCentral ScienCentral april benasich baby brain talk behavioural brain research cat1860 cognitive electroencephalogram communication eeg gamma wave gary marcus language neuroscience psychology rutgers toddler waves nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Green Gasoline Tue, 23 Sep 2008 20:34:03 -0800

Author: ScienCentral
Added: Tue, 23 Sep 2008 20:34:03 -0800
Duration: 108

In just a few years, "Drill, baby, drill" could be replaced by "Grow, baby, grow." Scientists have shown they can make green gasoline, diesel, and jet fuel from plant sugars -- far different from today's biofuels.

]]> drill grow gasoline diesel jet http://revver.com/video/1186529/green-gasoline/ http://revver.com/watch/1186529 Green Gasoline In just a few years, "Drill, baby, drill" could be replaced by "Grow, baby, grow." Scientists have shown they can make green gasoline, diesel, and jet fuel from plant sugars -- far different from today's biofuels. In just a few years, "Drill, baby, drill" could be replaced by "Grow, baby, grow." Scientists have shown they can make green gasoline, diesel, and jet fuel from plant sugars -- far different from today's biofuels. ScienCentral ScienCentral drill grow gasoline diesel jet nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Scientists Win Lasker for micro-RNA Discovery Tue, 23 Sep 2008 15:53:18 -0800

Author: ScienCentral
Added: Tue, 23 Sep 2008 15:53:18 -0800
Duration: 447

The Lasker Foundation has announced that Doctors Victor Ambros, Gary Ruvkun, and David Baulcombe won the Lasker Medical Prize for their discovery of micro-RNA molecules, and their role in gene regulation.

]]> ambrosbaulcombecancer treatmentdnagenegenetic diseasemicro-rnanematodepeptideruvkunsmall rna http://revver.com/video/1185571/scientists-win-lasker-for-micro-rna-discovery/ http://revver.com/watch/1185571 Scientists Win Lasker for micro-RNA Discovery The Lasker Foundation has announced that Doctors Victor Ambros, Gary Ruvkun, and David Baulcombe won the Lasker Medical Prize for their discovery of micro-RNA molecules, and their role in gene regulation. The Lasker Foundation has announced that Doctors Victor Ambros, Gary Ruvkun, and David Baulcombe won the Lasker Medical Prize for their discovery of micro-RNA molecules, and their role in gene regulation. ScienCentral ScienCentral ambros baulcombe cancer treatment dna gene genetic disease micro-rna nematode peptide ruvkun small rna nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Fish Comeback Mon, 22 Sep 2008 22:53:14 -0800

Author: ScienCentral
Added: Mon, 22 Sep 2008 22:53:14 -0800
Duration: 109

Could a change in the rules governing commercial fishing actually reverse a worldwide trend of declining fish populations? As this ScienCentral video explains, a just-released study of where those rules have changed says, "yes".

]]> acidityalaskabrencatch-sharechristopher costellocollapsedonaldecologyenvironmental sciencefishfishermanfisheryfishing seasonglobal warminghalibutmarinepopulationrace to stocksharesteven gaines http://revver.com/video/1185512/fish-comeback/ http://revver.com/watch/1185512 Fish Comeback Could a change in the rules governing commercial fishing actually reverse a worldwide trend of declining fish populations? As this ScienCentral video explains, a just-released study of where those rules have changed says, "yes". Could a change in the rules governing commercial fishing actually reverse a worldwide trend of declining fish populations? As this ScienCentral video explains, a just-released study of where those rules have changed says, "yes". ScienCentral ScienCentral acidity alaska bren catch-share christopher costello collapse donald ecology environmental science fish fisherman fishery fishing season global warming halibut marine population race to stock share steven gaines nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Hearing Motion Mon, 22 Sep 2008 16:33:56 -0800

Author: ScienCentral
Added: Mon, 22 Sep 2008 16:33:56 -0800
Duration: 111

Imagine if words created a taste in your mouth, or music created bursts of color. This rare condition, called synesthesia, results in your senses being crossed. As this ScienCentral News video reports, researchers have now found people who "hear" motion.

]]> brainesphearinglsdmotionneurobiologyperceptionsensessensorysynesthesia http://revver.com/video/1169094/hearing-motion/ http://revver.com/watch/1169094 Hearing Motion Imagine if words created a taste in your mouth, or music created bursts of color. This rare condition, called synesthesia, results in your senses being crossed. As this ScienCentral News video reports, researchers have now found people who "hear" motion. Imagine if words created a taste in your mouth, or music created bursts of color. This rare condition, called synesthesia, results in your senses being crossed. As this ScienCentral News video reports, researchers have now found people who "hear" motion. ScienCentral ScienCentral brain esp hearing lsd motion neurobiology perception senses sensory synesthesia nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Genetic Geography Mon, 22 Sep 2008 11:53:12 -0800

Author: ScienCentral
Added: Mon, 22 Sep 2008 11:53:12 -0800
Duration: 122

Genes don't just tell whom you're related to or why you look a certain way; now, they can also tell you where you came from. Researchers have created a genetic map of Europe, and they hope to expand it globally, as this ScienCentral News video explains.

]]> ancestrycarlos bustamantecat1850databasednaeuropegenegenetic mapgenomegeographyglaxoglaxosmithklinegskheritagejohn novembrematthew nelsonnaturenovembersnp http://revver.com/video/1193834/genetic-geography/ http://revver.com/watch/1193834 Genetic Geography Genes don't just tell whom you're related to or why you look a certain way; now, they can also tell you where you came from. Researchers have created a genetic map of Europe, and they hope to expand it globally, as this ScienCentral News video explains. Genes don't just tell whom you're related to or why you look a certain way; now, they can also tell you where you came from. Researchers have created a genetic map of Europe, and they hope to expand it globally, as this ScienCentral News video explains. ScienCentral ScienCentral ancestry carlos bustamante cat1850 database dna europe gene genetic map genome geography glaxo glaxosmithkline gsk heritage john novembre matthew nelson nature november snp nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Monkey See, Monkey Give Sat, 20 Sep 2008 07:52:59 -0800

Author: ScienCentral
Added: Sat, 20 Sep 2008 07:52:59 -0800
Duration: 113

The idea that "It's better to give than receive" may not be limited to just humans. As this ScienCentral Video explains, researchers have found a group of monkeys that seem to get pleasure from giving.

]]> capuchinfrans de waalgiftmonkeypro-socialselfishyerkes http://revver.com/video/1170100/monkey-see-monkey-give/ http://revver.com/watch/1170100 Monkey See, Monkey Give The idea that "It's better to give than receive" may not be limited to just humans. As this ScienCentral Video explains, researchers have found a group of monkeys that seem to get pleasure from giving. The idea that "It's better to give than receive" may not be limited to just humans. As this ScienCentral Video explains, researchers have found a group of monkeys that seem to get pleasure from giving. ScienCentral ScienCentral capuchin frans de waal gift monkey pro-social selfish yerkes nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Does Pleasure Get Old? Wed, 17 Sep 2008 07:55:41 -0800

Author: ScienCentral
Added: Wed, 17 Sep 2008 07:55:41 -0800
Duration: 98

They say youth is wasted on the young, but the truth may be the opposite. A first-of-its-kind study, out today, shows a drastic change in how our brains respond to pleasure and reward as we age. But as this ScienCentral News video explains, the research also shows that our brains can adjust to these changes.

]]> agingalzheimer'sbraindementiadopaminegolden yearsmental illnesspleasurerewardriskyouth http://revver.com/video/1178340/does-pleasure-get-old/ http://revver.com/watch/1178340 Does Pleasure Get Old? They say youth is wasted on the young, but the truth may be the opposite. A first-of-its-kind study, out today, shows a drastic change in how our brains respond to pleasure and reward as we age. But as this ScienCentral News video explains, the research also shows that our brains can adjust to these changes. They say youth is wasted on the young, but the truth may be the opposite. A first-of-its-kind study, out today, shows a drastic change in how our brains respond to pleasure and reward as we age. But as this ScienCentral News video explains, the research also shows that our brains can adjust to these changes. ScienCentral ScienCentral aging alzheimer's brain dementia dopamine golden years mental illness pleasure reward risk youth nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ A hole in the head: Golf and Perception Mon, 08 Sep 2008 15:55:28 -0800

Author: ScienCentral
Added: Mon, 08 Sep 2008 15:55:28 -0800
Duration: 112

Psychologists have found that golfers who've played well perceive the hole as bigger than it really is. As this ScienCentral video explains, the researchers also found those who did poorly saw the hole as smaller than it really is.

]]> athletebeachballbig shotbodybraincognitiongolfholehole in onejessica wittmindmoney ballperceptionpsychonomic bulletin and reviepurdue universityslumpssoftballstreaks http://revver.com/video/1161614/a-hole-in-the-head-golf-and-perception/ http://revver.com/watch/1161614 A hole in the head: Golf and Perception Psychologists have found that golfers who've played well perceive the hole as bigger than it really is. As this ScienCentral video explains, the researchers also found those who did poorly saw the hole as smaller than it really is. Psychologists have found that golfers who've played well perceive the hole as bigger than it really is. As this ScienCentral video explains, the researchers also found those who did poorly saw the hole as smaller than it really is. ScienCentral ScienCentral athlete beachball big shot body brain cognition golf hole hole in one jessica witt mind money ball perception psychonomic bulletin and revie purdue university slumps softball streaks nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ CO2 and Plant Pests Wed, 03 Sep 2008 17:55:00 -0800

Author: ScienCentral
Added: Wed, 03 Sep 2008 17:55:00 -0800
Duration: 110

Researchers are finding that rising levels of carbon dioxide in the air might be bad for our gardens and food prices, even though plants need CO2 to breathe. As this ScienCentral News video explains, research is showing that too much CO2 can make at least one major crop more vulnerable to pests.

]]> beetlesbugscarbon dioxideclimateco2environmentevan deluciafoodgardensgasgreenhouseinsectsjapanese beetlespestsplantssoybean http://revver.com/video/1149840/co2-and-plant-pests/ http://revver.com/watch/1149840 CO2 and Plant Pests Researchers are finding that rising levels of carbon dioxide in the air might be bad for our gardens and food prices, even though plants need CO2 to breathe. As this ScienCentral News video explains, research is showing that too much CO2 can make at least one major crop more vulnerable to pests. Researchers are finding that rising levels of carbon dioxide in the air might be bad for our gardens and food prices, even though plants need CO2 to breathe. As this ScienCentral News video explains, research is showing that too much CO2 can make at least one major crop more vulnerable to pests. ScienCentral ScienCentral beetles bugs carbon dioxide climate co2 environment evan delucia food gardens gas greenhouse insects japanese beetles pests plants soybean nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Fast Fat Mon, 01 Sep 2008 20:35:35 -0800

Author: ScienCentral
Added: Mon, 01 Sep 2008 20:35:35 -0800
Duration: 113

When it comes to making fat, not all sugars are created equal. As this ScienCentral News video reports, scientists are finding that fructose could be making us fatter, faster.

]]> carbohydratescorn syrupdietelizabeth parksfastfatfatty acidfructoseglucosehealthhigh fructose corn syrupjunk foodlose weight fastmarion nestleobesityoverweightsucrosesugarweight gainweight loss http://revver.com/video/1140499/fast-fat/ http://revver.com/watch/1140499 Fast Fat When it comes to making fat, not all sugars are created equal. As this ScienCentral News video reports, scientists are finding that fructose could be making us fatter, faster. When it comes to making fat, not all sugars are created equal. As this ScienCentral News video reports, scientists are finding that fructose could be making us fatter, faster. ScienCentral ScienCentral carbohydrates corn syrup diet elizabeth parks fast fat fatty acid fructose glucose health high fructose corn syrup junk food lose weight fast marion nestle obesity overweight sucrose sugar weight gain weight loss nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Organ Repair Fri, 29 Aug 2008 12:35:18 -0800

Author: ScienCentral
Added: Fri, 29 Aug 2008 12:35:18 -0800
Duration: 103

For the first time, researchers have prevented the typical age-related decline in a whole organ, allowing old mice to have livers that keep working like when they were young. This ScienCentral News video eports on a strategy that researchers think could lead to treatments for age-related decline in other organs, such as the brain. Brain animation courtesy iStockphoto.com/Piotr Podermanski.

]]> ageage reversalalbert einstein college of medalzheimer'sana maria cuervobraincellcong zhanggarbagegenegene therapygeneticsliverlysosomemicemouseorgan ageorganelleorgansoxidizationparkinson'sproteinrustskinwrinkles http://revver.com/video/1139651/organ-repair/ http://revver.com/watch/1139651 Organ Repair For the first time, researchers have prevented the typical age-related decline in a whole organ, allowing old mice to have livers that keep working like when they were young. This ScienCentral News video eports on a strategy that researchers think could lead to treatments for age-related decline in other organs, such as the brain. Brain animation courtesy iStockphoto.com/Piotr Podermanski. For the first time, researchers have prevented the typical age-related decline in a whole organ, allowing old mice to have livers that keep working like when they were young. This ScienCentral News video eports on a strategy that researchers think could lead to treatments for age-related decline in other organs, such as the brain. Brain animation courtesy iStockphoto.com/Piotr Podermanski. ScienCentral ScienCentral age age reversal albert einstein college of med alzheimer's ana maria cuervo brain cell cong zhang garbage gene gene therapy genetics liver lysosome mice mouse organ age organelle organs oxidization parkinson's protein rust skin wrinkles nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Acid Oceans Thu, 28 Aug 2008 08:35:08 -0800

Author: ScienCentral
Added: Thu, 28 Aug 2008 08:35:08 -0800
Duration: 115

New research is showing that carbon dioxide is not only causing global warming, but it's also causing sea water to become more acidic. As this ScienCentral News video explains, the implications of this on underwater life is becoming a hot topic for everyone from scientists, to IMAX filmmakers.

]]> 3dacid oceansacidificationglobal warminghoward hallimaxunder the sea http://revver.com/video/1135155/acid-oceans/ http://revver.com/watch/1135155 Acid Oceans New research is showing that carbon dioxide is not only causing global warming, but it's also causing sea water to become more acidic. As this ScienCentral News video explains, the implications of this on underwater life is becoming a hot topic for everyone from scientists, to IMAX filmmakers. New research is showing that carbon dioxide is not only causing global warming, but it's also causing sea water to become more acidic. As this ScienCentral News video explains, the implications of this on underwater life is becoming a hot topic for everyone from scientists, to IMAX filmmakers. ScienCentral ScienCentral 3d acid oceans acidification global warming howard hall imax under the sea nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Street Corner Science with Leon Lederman Part 2 Wed, 27 Aug 2008 08:36:23 -0800

Author: ScienCentral
Added: Wed, 27 Aug 2008 08:36:23 -0800
Duration: 236

Part 2 of 2. ScienCentral is taking science to the people in its latest installment of "Street Corner Science", in which a film crew and a renowned scientist are plunked down on a busy city street corner, and an impromptu Q&A session with the public ensues!

]]> cernfusiongod particlehiggs bosoninterviewiterleon ledermanlhcnobelnobel prizenuclear forceparticle physicsphysicistphysicsq&aquestionssciencesingularityspacestreet corner sciencestrong forcetime travel http://revver.com/video/1133535/street-corner-science-with-leon-lederman-part-2/ http://revver.com/watch/1133535 Street Corner Science with Leon Lederman Part 2 Part 2 of 2. ScienCentral is taking science to the people in its latest installment of "Street Corner Science", in which a film crew and a renowned scientist are plunked down on a busy city street corner, and an impromptu Q&A session with the public ensues! Part 2 of 2. ScienCentral is taking science to the people in its latest installment of "Street Corner Science", in which a film crew and a renowned scientist are plunked down on a busy city street corner, and an impromptu Q&A session with the public ensues! ScienCentral ScienCentral cern fusion god particle higgs boson interview iter leon lederman lhc nobel nobel prize nuclear force particle physics physicist physics q&a questions science singularity space street corner science strong force time travel nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bat Wind Deaths Mon, 25 Aug 2008 23:55:24 -0800

Author: ScienCentral
Added: Mon, 25 Aug 2008 23:55:24 -0800
Duration: 103

The big knock on wind turbines has been that they're dangerous to birds. But researchers have found that they actually kill more bats, and the reason why has been a mystery--until now. As this ScienCentral News video explains, a study published today finds the bats are actually drowning in mid-air.

]]> batbatsdrowningdying batsenergyerin baerwaldgreenkenny breuerlungspressuresharon swartzthe bendsturbinewindmill http://revver.com/video/1130947/bat-wind-deaths/ http://revver.com/watch/1130947 Bat Wind Deaths The big knock on wind turbines has been that they're dangerous to birds. But researchers have found that they actually kill more bats, and the reason why has been a mystery--until now. As this ScienCentral News video explains, a study published today finds the bats are actually drowning in mid-air. The big knock on wind turbines has been that they're dangerous to birds. But researchers have found that they actually kill more bats, and the reason why has been a mystery--until now. As this ScienCentral News video explains, a study published today finds the bats are actually drowning in mid-air. ScienCentral ScienCentral bat bats drowning dying bats energy erin baerwald green kenny breuer lungs pressure sharon swartz the bends turbine windmill nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Street Corner Science with Leon Lederman Thu, 21 Aug 2008 19:55:05 -0800

Author: ScienCentral
Added: Thu, 21 Aug 2008 19:55:05 -0800
Duration: 211

ScienCentral is taking science to the people in its first installment of "Street Corner Science", in which a film crew and a renowned scientist are plunked down on a busy city street corner, and an impromptu Q&A session with the public ensues!

]]> fusiongod particleinterviewleon ledermannobelnobel prizenuclear forcephysicistphysicsq&aquestionssciencesingularityspacestreet corner sciencestrong force http://revver.com/video/1123663/street-corner-science-with-leon-lederman/ http://revver.com/watch/1123663 Street Corner Science with Leon Lederman ScienCentral is taking science to the people in its first installment of "Street Corner Science", in which a film crew and a renowned scientist are plunked down on a busy city street corner, and an impromptu Q&A session with the public ensues! ScienCentral is taking science to the people in its first installment of "Street Corner Science", in which a film crew and a renowned scientist are plunked down on a busy city street corner, and an impromptu Q&A session with the public ensues! ScienCentral ScienCentral fusion god particle interview leon lederman nobel nobel prize nuclear force physicist physics q&a questions science singularity space street corner science strong force nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ HIV-Immune Cells Thu, 21 Aug 2008 19:55:05 -0800

Author: ScienCentral
Added: Thu, 21 Aug 2008 19:55:05 -0800
Duration: 108

Doctors are considering using a new technology to genetically modify AIDS patients' own cells to be resistant to HIV. As this ScienCentral News video explains, they're modeling the idea after rare individuals who are naturally immune to the AIDS virus.

]]> aidscarl junecat1690delta 32dnaelena perezgeneticshivimmuneimmunityimmunologynature biotechnologyphilip gregorysangamo biosciencesviruszfpzfpszinc finger proteins http://revver.com/video/1124087/hiv-immune-cells/ http://revver.com/watch/1124087 HIV-Immune Cells Doctors are considering using a new technology to genetically modify AIDS patients' own cells to be resistant to HIV. As this ScienCentral News video explains, they're modeling the idea after rare individuals who are naturally immune to the AIDS virus. Doctors are considering using a new technology to genetically modify AIDS patients' own cells to be resistant to HIV. As this ScienCentral News video explains, they're modeling the idea after rare individuals who are naturally immune to the AIDS virus. ScienCentral ScienCentral aids carl june cat1690 delta 32 dna elena perez genetics hiv immune immunity immunology nature biotechnology philip gregory sangamo biosciences virus zfp zfps zinc finger proteins nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Skin Cancer Smell Wed, 20 Aug 2008 09:54:57 -0800

Author: ScienCentral
Added: Wed, 20 Aug 2008 09:54:57 -0800
Duration: 93

Research announced today at a conference of the nation's leading chemists confirms that skin with cancer gives off a different odor than normal skin. ScienCentral reports on the first odor profile for skin cancer, and how it could lead to new cancer sniffing technology.

]]> skin cancer smell odor sniffin http://revver.com/video/1120733/skin-cancer-smell/ http://revver.com/watch/1120733 Skin Cancer Smell Research announced today at a conference of the nation's leading chemists confirms that skin with cancer gives off a different odor than normal skin. ScienCentral reports on the first odor profile for skin cancer, and how it could lead to new cancer sniffing technology. Research announced today at a conference of the nation's leading chemists confirms that skin with cancer gives off a different odor than normal skin. ScienCentral reports on the first odor profile for skin cancer, and how it could lead to new cancer sniffing technology. ScienCentral ScienCentral skin cancer smell odor sniffin nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Red Olympic Advantage Tue, 19 Aug 2008 11:19:46 -0800

Author: ScienCentral
Added: Tue, 19 Aug 2008 11:19:46 -0800
Duration: 112

Wondering who's got an edge in the next game or Olympic event? Here's a hint: watch out for the contenders in red.

]]> colorcompetitionjudgingmartial artsolympicpsychologyredscoringsportstaekwondounfair http://revver.com/video/1116937/red-olympic-advantage/ http://revver.com/watch/1116937 Red Olympic Advantage Wondering who's got an edge in the next game or Olympic event? Here's a hint: watch out for the contenders in red. Wondering who's got an edge in the next game or Olympic event? Here's a hint: watch out for the contenders in red. ScienCentral ScienCentral color competition judging martial arts olympic psychology red scoring sports taekwondo unfair nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Ask an Astronaut: Buzz Aldrin Part 2 Thu, 14 Aug 2008 23:54:21 -0800

Author: ScienCentral
Added: Thu, 14 Aug 2008 23:54:21 -0800
Duration: 230

In this Web exclusive, ScienCentral caught up with Buzz Aldrin at the premiere of his new animated 3D movie "Fly Me to the Moon," and then took to the streets to gather questions for the iconic astronaut. Part 2 of 2.

]]> apollo 11astronautbuzz aldrinfly me to the moonmoonq&aquestionsspace http://revver.com/video/1109889/ask-an-astronaut-buzz-aldrin-part-2/ http://revver.com/watch/1109889 Ask an Astronaut: Buzz Aldrin Part 2 In this Web exclusive, ScienCentral caught up with Buzz Aldrin at the premiere of his new animated 3D movie "Fly Me to the Moon," and then took to the streets to gather questions for the iconic astronaut. Part 2 of 2. In this Web exclusive, ScienCentral caught up with Buzz Aldrin at the premiere of his new animated 3D movie "Fly Me to the Moon," and then took to the streets to gather questions for the iconic astronaut. Part 2 of 2. ScienCentral ScienCentral apollo 11 astronaut buzz aldrin fly me to the moon moon q&a questions space nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ The Happening: Garden-variety Horror Wed, 13 Aug 2008 22:54:23 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 22:54:23 -0800
Duration: 165

Just when you thought it was safe to go back in the garden! Cast and crew of "The Happening" discuss challenges in making this enviro-horror film. For more, check out ScienCentral for the original story on toxic plants, "The Happening and Plant Science".

]]> m night shyamalan the happenin http://revver.com/video/1106761/the-happening-garden-variety-horror/ http://revver.com/watch/1106761 The Happening: Garden-variety Horror Just when you thought it was safe to go back in the garden! Cast and crew of "The Happening" discuss challenges in making this enviro-horror film. For more, check out ScienCentral for the original story on toxic plants, "The Happening and Plant Science". Just when you thought it was safe to go back in the garden! Cast and crew of "The Happening" discuss challenges in making this enviro-horror film. For more, check out ScienCentral for the original story on toxic plants, "The Happening and Plant Science". ScienCentral ScienCentral m night shyamalan the happenin nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bee Disease Spread Wed, 13 Aug 2008 22:54:23 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 22:54:23 -0800
Duration: 113

A new clue in the mysterious decline of bee populations: researchers have found that diseases are spreading from domesticated bumblebees to those in the wild. As this ScienCentral News video reports, that's leaving many species in danger of disappearing.

]]> beebumblebeedeclinediseasedomesticatedparasitespecies http://revver.com/video/1107309/bee-disease-spread/ http://revver.com/watch/1107309 Bee Disease Spread A new clue in the mysterious decline of bee populations: researchers have found that diseases are spreading from domesticated bumblebees to those in the wild. As this ScienCentral News video reports, that's leaving many species in danger of disappearing. A new clue in the mysterious decline of bee populations: researchers have found that diseases are spreading from domesticated bumblebees to those in the wild. As this ScienCentral News video reports, that's leaving many species in danger of disappearing. ScienCentral ScienCentral bee bumblebee decline disease domesticated parasite species nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Ask an Astronaut: Buzz Aldrin Part 1 Wed, 13 Aug 2008 13:54:19 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 13:54:19 -0800
Duration: 255

In this Web exclusive, ScienCentral caught up with Buzz Aldrin at the premiere of his new animated 3D movie "Fly Me to the Moon," and then took to the streets to gather questions for the iconic astronaut. Part 1 of 2.

]]> apollo 11 astronaut buzz aldri http://revver.com/video/1106448/ask-an-astronaut-buzz-aldrin-part-1/ http://revver.com/watch/1106448 Ask an Astronaut: Buzz Aldrin Part 1 In this Web exclusive, ScienCentral caught up with Buzz Aldrin at the premiere of his new animated 3D movie "Fly Me to the Moon," and then took to the streets to gather questions for the iconic astronaut. Part 1 of 2. In this Web exclusive, ScienCentral caught up with Buzz Aldrin at the premiere of his new animated 3D movie "Fly Me to the Moon," and then took to the streets to gather questions for the iconic astronaut. Part 1 of 2. ScienCentral ScienCentral apollo 11 astronaut buzz aldri nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Red Wine Aging Drug Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 120

Could a pill that's designed to treat Type 2 Diabetes also be the first anti-aging drug? As this ScienCentral News video explains, the pills are based on a substance in, of all things, red wine.

]]> aginganti-agingdiabetesresveratrolsirtrissupplement http://revver.com/video/1097070/red-wine-aging-drug/ http://revver.com/watch/1097070 Red Wine Aging Drug Could a pill that's designed to treat Type 2 Diabetes also be the first anti-aging drug? As this ScienCentral News video explains, the pills are based on a substance in, of all things, red wine. Could a pill that's designed to treat Type 2 Diabetes also be the first anti-aging drug? As this ScienCentral News video explains, the pills are based on a substance in, of all things, red wine. ScienCentral ScienCentral aging anti-aging diabetes resveratrol sirtris supplement nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Curly Hair Gene Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 109

Curly or straight? Too much or too little? If you don't like the hair you were born with, this ScienCentral News video reports that a scientific solution might be in the near future.

]]> curlscurlygenehairproteinsalonstylistwooly http://revver.com/video/1097073/curly-hair-gene/ http://revver.com/watch/1097073 Curly Hair Gene Curly or straight? Too much or too little? If you don't like the hair you were born with, this ScienCentral News video reports that a scientific solution might be in the near future. Curly or straight? Too much or too little? If you don't like the hair you were born with, this ScienCentral News video reports that a scientific solution might be in the near future. ScienCentral ScienCentral curls curly gene hair protein salon stylist wooly nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Emergency Stroke Drug Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 119

Millions of Americans are living with the aftermath of having a stroke. A former Miss Arizona talks about her stroke at age 26, and this ScienCentral News video explains how researchers are looking for safer ways to treat strokes when they happen.

]]> busterclotemergencystroke http://revver.com/video/1097074/emergency-stroke-drug/ http://revver.com/watch/1097074 Emergency Stroke Drug Millions of Americans are living with the aftermath of having a stroke. A former Miss Arizona talks about her stroke at age 26, and this ScienCentral News video explains how researchers are looking for safer ways to treat strokes when they happen. Millions of Americans are living with the aftermath of having a stroke. A former Miss Arizona talks about her stroke at age 26, and this ScienCentral News video explains how researchers are looking for safer ways to treat strokes when they happen. ScienCentral ScienCentral buster clot emergency stroke nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ "The Happening" and Plant Science Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 136

In "The Happening," common plants release a neurotoxin that threatens the survival of the human race. This movie premise may be far-fetched, but scientists say summer is a good time to familiarize yourself with toxic plants that can be harmful to your health. This ScienCentral News video has more.

]]> apocalypsebotanyenvironmentflowersgardeninghappeningherbsmmarkmysteryneurotoxinnightplantssci-fishyamalanthewahlberg http://revver.com/video/1097075/the-happening-and-plant-science/ http://revver.com/watch/1097075 "The Happening" and Plant Science In "The Happening," common plants release a neurotoxin that threatens the survival of the human race. This movie premise may be far-fetched, but scientists say summer is a good time to familiarize yourself with toxic plants that can be harmful to your health. This ScienCentral News video has more. In "The Happening," common plants release a neurotoxin that threatens the survival of the human race. This movie premise may be far-fetched, but scientists say summer is a good time to familiarize yourself with toxic plants that can be harmful to your health. This ScienCentral News video has more. ScienCentral ScienCentral apocalypse botany environment flowers gardening happening herbs m mark mystery neurotoxin night plants sci-fi shyamalan the wahlberg nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Snakes on the Brain Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 105

New research by psychologists suggests we're born ready to look for snakes. As this ScienCentral News video reports, a series of experiments showed that people, even toddlers tend to recognize and locate a snake faster than other plants and animals.

]]> brainevolutionfearophidiophobiaphobiapsychologysnakes http://revver.com/video/1097076/snakes-on-the-brain/ http://revver.com/watch/1097076 Snakes on the Brain New research by psychologists suggests we're born ready to look for snakes. As this ScienCentral News video reports, a series of experiments showed that people, even toddlers tend to recognize and locate a snake faster than other plants and animals. New research by psychologists suggests we're born ready to look for snakes. As this ScienCentral News video reports, a series of experiments showed that people, even toddlers tend to recognize and locate a snake faster than other plants and animals. ScienCentral ScienCentral brain evolution fear ophidiophobia phobia psychology snakes nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Blind Dog Cure Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 118

A dying and blind dog was given a last opportunity to see, thanks to a veterinarian who has figured out why some dogs suddenly go blind. This ScienCentral News video explains.

]]> antibodiesautoimmuneblindblindnessdogeyegoldenretrieverroxivision http://revver.com/video/1097077/blind-dog-cure/ http://revver.com/watch/1097077 Blind Dog Cure A dying and blind dog was given a last opportunity to see, thanks to a veterinarian who has figured out why some dogs suddenly go blind. This ScienCentral News video explains. A dying and blind dog was given a last opportunity to see, thanks to a veterinarian who has figured out why some dogs suddenly go blind. This ScienCentral News video explains. ScienCentral ScienCentral antibodies autoimmune blind blindness dog eye golden retriever roxi vision nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Moms Who Listen Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 106

This Mothers' Day, thank your mom for listening. That's because psychologists now say that explaining things to your mom actually helps you learn better.

]]> educationlearningmotherpatternpreschoolpsychology http://revver.com/video/1097078/moms-who-listen/ http://revver.com/watch/1097078 Moms Who Listen This Mothers' Day, thank your mom for listening. That's because psychologists now say that explaining things to your mom actually helps you learn better. This Mothers' Day, thank your mom for listening. That's because psychologists now say that explaining things to your mom actually helps you learn better. ScienCentral ScienCentral education learning mother pattern preschool psychology nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bad Belly Fat Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 108

Scientists are finding more about how that bulge around your belly is more harmful than the pounds you may have elsewhere on your body. As this ScienCentral News video reports, belly fat may cause blockages in the arteries, and the finding could lead to better drugs to protect against heart disease.

]]> apple-shapearteriescholesteroldiabetesdrugsfatinflammationobesity http://revver.com/video/1097079/bad-belly-fat/ http://revver.com/watch/1097079 Bad Belly Fat Scientists are finding more about how that bulge around your belly is more harmful than the pounds you may have elsewhere on your body. As this ScienCentral News video reports, belly fat may cause blockages in the arteries, and the finding could lead to better drugs to protect against heart disease. Scientists are finding more about how that bulge around your belly is more harmful than the pounds you may have elsewhere on your body. As this ScienCentral News video reports, belly fat may cause blockages in the arteries, and the finding could lead to better drugs to protect against heart disease. ScienCentral ScienCentral apple-shape arteries cholesterol diabetes drugs fat inflammation obesity nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ CO2 For Allergies Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 110

Allergy season is here, and along with your hay fever, you may be experiencing the annoying side effects of today's drugs. But a new treatment for allergies--with fewer side effects--might come from the same substance blamed for global warming, carbon dioxide. This ScienCentral News video explains.

]]> allergiescarbondioxidefeverhayrhinitisseasonsneeze http://revver.com/video/1097080/co2-for-allergies/ http://revver.com/watch/1097080 CO2 For Allergies Allergy season is here, and along with your hay fever, you may be experiencing the annoying side effects of today's drugs. But a new treatment for allergies--with fewer side effects--might come from the same substance blamed for global warming, carbon dioxide. This ScienCentral News video explains. Allergy season is here, and along with your hay fever, you may be experiencing the annoying side effects of today's drugs. But a new treatment for allergies--with fewer side effects--might come from the same substance blamed for global warming, carbon dioxide. This ScienCentral News video explains. ScienCentral ScienCentral allergies carbon dioxide fever hay rhinitis season sneeze nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Brain Size and Alzheimer's Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 106

BrResearchers now say that having a big brain may protect you from the memory-stealing symptoms of Alzheimer's Disease, even if you have the brain plaques associated with the disease.

]]> alzheimersbraindiseasehippocampusmemoryplaquessizetangles http://revver.com/video/1097081/brain-size-and-alzheimers/ http://revver.com/watch/1097081 Brain Size and Alzheimer's BrResearchers now say that having a big brain may protect you from the memory-stealing symptoms of Alzheimer's Disease, even if you have the brain plaques associated with the disease. BrResearchers now say that having a big brain may protect you from the memory-stealing symptoms of Alzheimer's Disease, even if you have the brain plaques associated with the disease. ScienCentral ScienCentral alzheimers brain disease hippocampus memory plaques size tangles nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mars Rover Anniversary Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 106

It's the fourth anniversary of NASA's rover mission to Mars and both "Spirit" and "Opportunity" have made it to spots where their solar panels are getting enough power from the planets' weak winter sunlight. As this ScienCentral News explains, the anniversary marks another incredible milestone, because the rovers were expected to last only a few months.

]]> marsnasaopportunityroverspiritsquyres http://revver.com/video/1097083/mars-rover-anniversary/ http://revver.com/watch/1097083 Mars Rover Anniversary It's the fourth anniversary of NASA's rover mission to Mars and both "Spirit" and "Opportunity" have made it to spots where their solar panels are getting enough power from the planets' weak winter sunlight. As this ScienCentral News explains, the anniversary marks another incredible milestone, because the rovers were expected to last only a few months. It's the fourth anniversary of NASA's rover mission to Mars and both "Spirit" and "Opportunity" have made it to spots where their solar panels are getting enough power from the planets' weak winter sunlight. As this ScienCentral News explains, the anniversary marks another incredible milestone, because the rovers were expected to last only a few months. ScienCentral ScienCentral mars nasa opportunity rover spirit squyres nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Tip of the Tongue Learning Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 104

When you can't quite remember a tricky word or somebody's name, trying to excavate it from your memory might be the worst thing you can do, according to new psychology research. This ScienCentral News video explains.

]]> agingbrainfindinglearningmcmastermemorypsychologyrecalltongueword http://revver.com/video/1097084/tip-of-the-tongue-learning/ http://revver.com/watch/1097084 Tip of the Tongue Learning When you can't quite remember a tricky word or somebody's name, trying to excavate it from your memory might be the worst thing you can do, according to new psychology research. This ScienCentral News video explains. When you can't quite remember a tricky word or somebody's name, trying to excavate it from your memory might be the worst thing you can do, according to new psychology research. This ScienCentral News video explains. ScienCentral ScienCentral aging brain finding learning mcmaster memory psychology recall tongue word nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Fly Flight Simulators Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 109

They don't call them flies for nothing. While we try to avoid the relentless aerial acrobatics of flies, some scientists have built them their own flight simulator. As this ScienCentral News video reports, the work could lead to new flying robots.

]]> behaviorflightflyinsectledmicrobotnanorobotneuroethologypanoramarobot http://revver.com/video/1097085/fly-flight-simulators/ http://revver.com/watch/1097085 Fly Flight Simulators They don't call them flies for nothing. While we try to avoid the relentless aerial acrobatics of flies, some scientists have built them their own flight simulator. As this ScienCentral News video reports, the work could lead to new flying robots. They don't call them flies for nothing. While we try to avoid the relentless aerial acrobatics of flies, some scientists have built them their own flight simulator. As this ScienCentral News video reports, the work could lead to new flying robots. ScienCentral ScienCentral behavior flight fly insect led microbot nanorobot neuroethology panorama robot nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ The Real WALL-E Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 125

The new Disney movie WALL-E features robots of the future actively helping humans. But the future is now. This ScienCentral News video reports on a real robot that could help us take care of elderly relatives from miles away.

]]> asimoassistelderlyhelperrobotroombaubotwall-e http://revver.com/video/1097087/the-real-wall-e/ http://revver.com/watch/1097087 The Real WALL-E The new Disney movie WALL-E features robots of the future actively helping humans. But the future is now. This ScienCentral News video reports on a real robot that could help us take care of elderly relatives from miles away. The new Disney movie WALL-E features robots of the future actively helping humans. But the future is now. This ScienCentral News video reports on a real robot that could help us take care of elderly relatives from miles away. ScienCentral ScienCentral asimo assist elderly helper robot roomba ubot wall-e nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Height and Long Life Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 109

As the infamous Randy Newman song goes, "Short people got no reason to live." Well, researchers now say some short people might actually be living longer, thanks to their genes. This ScienCentral News video explains how a gene that affects people's growth might also help control aging.

]]> ageashkenazigenesgeneticsheightjewishlifelonglongevityold http://revver.com/video/1097088/height-and-long-life/ http://revver.com/watch/1097088 Height and Long Life As the infamous Randy Newman song goes, "Short people got no reason to live." Well, researchers now say some short people might actually be living longer, thanks to their genes. This ScienCentral News video explains how a gene that affects people's growth might also help control aging. As the infamous Randy Newman song goes, "Short people got no reason to live." Well, researchers now say some short people might actually be living longer, thanks to their genes. This ScienCentral News video explains how a gene that affects people's growth might also help control aging. ScienCentral ScienCentral age ashkenazi genes genetics height jewish life long longevity old nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Heart Medicine Gene Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 139

Genetics researchers have debunked a racial myth about who might benefit from a widely used heart failure medication. As this ScienCentral video reports, the finding will eventually allow personalized treatments for this devastating disease.

]]> africanamericanbeta-blockerblackdiseasegeneticheartpersonalizedrace http://revver.com/video/1097090/heart-medicine-gene/ http://revver.com/watch/1097090 Heart Medicine Gene Genetics researchers have debunked a racial myth about who might benefit from a widely used heart failure medication. As this ScienCentral video reports, the finding will eventually allow personalized treatments for this devastating disease. Genetics researchers have debunked a racial myth about who might benefit from a widely used heart failure medication. As this ScienCentral video reports, the finding will eventually allow personalized treatments for this devastating disease. ScienCentral ScienCentral african american beta-blocker black disease genetic heart personalized race nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Cancer Control Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 111

Scientists have discovered molecules that can determine whether cancer tumors will spread to other parts of the body. As this ScienCentral News video explains, the tiny molecules prevent tumors from spreading.

]]> breastcancermicrornapreventionrnatavazoietumor http://revver.com/video/1097092/cancer-control/ http://revver.com/watch/1097092 Cancer Control Scientists have discovered molecules that can determine whether cancer tumors will spread to other parts of the body. As this ScienCentral News video explains, the tiny molecules prevent tumors from spreading. Scientists have discovered molecules that can determine whether cancer tumors will spread to other parts of the body. As this ScienCentral News video explains, the tiny molecules prevent tumors from spreading. ScienCentral ScienCentral breast cancer microrna prevention rna tavazoie tumor nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Asthma Vest Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 113

Scientists are trying out a new tool to determine what triggers asthma attacks, especially in children. As this ScienCentral report explains, engineers have created a vest full of air sampling equipment that monitors and records what's in the air.

]]> asthmaattackchemicalschildrenexposuresensor http://revver.com/video/1097093/asthma-vest/ http://revver.com/watch/1097093 Asthma Vest Scientists are trying out a new tool to determine what triggers asthma attacks, especially in children. As this ScienCentral report explains, engineers have created a vest full of air sampling equipment that monitors and records what's in the air. Scientists are trying out a new tool to determine what triggers asthma attacks, especially in children. As this ScienCentral report explains, engineers have created a vest full of air sampling equipment that monitors and records what's in the air. ScienCentral ScienCentral asthma attack chemicals children exposure sensor nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ "Jumper" and Real Teleportation Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 132

From "Star Trek" to the new sci-fi film "Jumper," we're all familiar with the idea of teleportation. But as this ScienCentral News video explains, scientists are actually doing real teleportation experiments in the lab.

]]> christensencomputinghaydenjumperquantumtelecloningteleportation http://revver.com/video/1097094/jumper-and-real-teleportation/ http://revver.com/watch/1097094 "Jumper" and Real Teleportation From "Star Trek" to the new sci-fi film "Jumper," we're all familiar with the idea of teleportation. But as this ScienCentral News video explains, scientists are actually doing real teleportation experiments in the lab. From "Star Trek" to the new sci-fi film "Jumper," we're all familiar with the idea of teleportation. But as this ScienCentral News video explains, scientists are actually doing real teleportation experiments in the lab. ScienCentral ScienCentral christensen computing hayden jumper quantum telecloning teleportation nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Disarming AIDS Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 123

Scientists have discovered a weakness in the AIDS virus that could lead to a new class of treatments. As this ScienCentral News video explains, the virus acts like a hijacker, turning the body's own machinery against it. But the new research could deprive AIDS of those weapons.

]]> aidselledgegeneticshivproteinssteve http://revver.com/video/1097095/disarming-aids/ http://revver.com/watch/1097095 Disarming AIDS Scientists have discovered a weakness in the AIDS virus that could lead to a new class of treatments. As this ScienCentral News video explains, the virus acts like a hijacker, turning the body's own machinery against it. But the new research could deprive AIDS of those weapons. Scientists have discovered a weakness in the AIDS virus that could lead to a new class of treatments. As this ScienCentral News video explains, the virus acts like a hijacker, turning the body's own machinery against it. But the new research could deprive AIDS of those weapons. ScienCentral ScienCentral aids elledge genetics hiv proteins steve nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mind Reading Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 111

As pollsters have so well demonstrated this presidential primary season, reading minds, whether of voters or the person next to you, is close to impossible. However as this ScienCentral News video explains, scientists are actually one step closer to reading our thoughts.

]]> brainespmindreadingmrineuroscience http://revver.com/video/1097096/mind-reading/ http://revver.com/watch/1097096 Mind Reading As pollsters have so well demonstrated this presidential primary season, reading minds, whether of voters or the person next to you, is close to impossible. However as this ScienCentral News video explains, scientists are actually one step closer to reading our thoughts. As pollsters have so well demonstrated this presidential primary season, reading minds, whether of voters or the person next to you, is close to impossible. However as this ScienCentral News video explains, scientists are actually one step closer to reading our thoughts. ScienCentral ScienCentral brain esp mindreading mri neuroscience nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Supergreenhouse Climate Mystery Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 109

As global temperatures rise, glaciers melt and sea levels go up, right? Well, new research on prehistoric climates indicates that the opposite could somehow be true. As this ScienCentral News video reports, the findings add a new twist to how we think about climate change.

]]> climatefallicelevelsquestionriseseawarming http://revver.com/video/1097097/supergreenhouse-climate-mystery/ http://revver.com/watch/1097097 Supergreenhouse Climate Mystery As global temperatures rise, glaciers melt and sea levels go up, right? Well, new research on prehistoric climates indicates that the opposite could somehow be true. As this ScienCentral News video reports, the findings add a new twist to how we think about climate change. As global temperatures rise, glaciers melt and sea levels go up, right? Well, new research on prehistoric climates indicates that the opposite could somehow be true. As this ScienCentral News video reports, the findings add a new twist to how we think about climate change. ScienCentral ScienCentral climate fall ice levels question rise sea warming nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Lead and Alzheimer's Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 114

We've all heard about the hidden danger lead poses to our children, but what about those of us who were exposed to lead long ago? New research is showing lead exposure might lead to problems much later in life. This ScienCentral News video reports on early evidence of a link between lead and Alzheimer's Disease.

]]> alzheimeralzheimersbrainleadplaquepoisontoxic http://revver.com/video/1097098/lead-and-alzheimers/ http://revver.com/watch/1097098 Lead and Alzheimer's We've all heard about the hidden danger lead poses to our children, but what about those of us who were exposed to lead long ago? New research is showing lead exposure might lead to problems much later in life. This ScienCentral News video reports on early evidence of a link between lead and Alzheimer's Disease. We've all heard about the hidden danger lead poses to our children, but what about those of us who were exposed to lead long ago? New research is showing lead exposure might lead to problems much later in life. This ScienCentral News video reports on early evidence of a link between lead and Alzheimer's Disease. ScienCentral ScienCentral alzheimer alzheimers brain lead plaque poison toxic nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Scared Slow Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 106

After a car accident or other scary experience many people report feeling like the event happened in slow motion. One neuroscientist set out to test whether our brains really see things slowed down in response to fear. This ScienCentral News story shows why he had to scare people in order to do the experiment.

]]> accidentamygdalaperceptionscaredslowtime http://revver.com/video/1097100/scared-slow/ http://revver.com/watch/1097100 Scared Slow After a car accident or other scary experience many people report feeling like the event happened in slow motion. One neuroscientist set out to test whether our brains really see things slowed down in response to fear. This ScienCentral News story shows why he had to scare people in order to do the experiment. After a car accident or other scary experience many people report feeling like the event happened in slow motion. One neuroscientist set out to test whether our brains really see things slowed down in response to fear. This ScienCentral News story shows why he had to scare people in order to do the experiment. ScienCentral ScienCentral accident amygdala perception scared slow time nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Nano Hazards? Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 159

Tiny particles of silver designed to kill germs are being put into socks to control odor. But as this ScienCentral News video explains, what happens to that nanosilver later is concerning some scientists.

]]> bacteriaepagerminfectionmicrobicidenanoparticlespollutionsilver http://revver.com/video/1097101/nano-hazards/ http://revver.com/watch/1097101 Nano Hazards? Tiny particles of silver designed to kill germs are being put into socks to control odor. But as this ScienCentral News video explains, what happens to that nanosilver later is concerning some scientists. Tiny particles of silver designed to kill germs are being put into socks to control odor. But as this ScienCentral News video explains, what happens to that nanosilver later is concerning some scientists. ScienCentral ScienCentral bacteria epa germ infection microbicide nano particles pollution silver nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Cancer Chip Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 101

Researchers have found a new way to identify loose cancer cells in patients' blood. As this ScienCentral News video explains, use of a high tech chip could give doctors a quicker and less invasive way to tell if treatments are working.

]]> biopsycancerchipdetectionearlymicrofluidicsnanonanotechnologytumor http://revver.com/video/1097104/cancer-chip/ http://revver.com/watch/1097104 Cancer Chip Researchers have found a new way to identify loose cancer cells in patients' blood. As this ScienCentral News video explains, use of a high tech chip could give doctors a quicker and less invasive way to tell if treatments are working. Researchers have found a new way to identify loose cancer cells in patients' blood. As this ScienCentral News video explains, use of a high tech chip could give doctors a quicker and less invasive way to tell if treatments are working. ScienCentral ScienCentral biopsy cancer chip detection early microfluidics nano nanotechnology tumor nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Anti-Cancer Blood Transfusion Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 102

Researchers have announced today that they'll soon start human trials of a cancer fighting method that uses blood from people who may be naturally cancer resistant. As this ScienCentral News video explains, for a decade the researchers have studied how this works in mice, and now they've received federal approval to try it in people.

]]> bloodcancerhealthmedicinesciencetransfusiontumorsvideo http://revver.com/video/1097105/anti-cancer-blood-transfusion/ http://revver.com/watch/1097105 Anti-Cancer Blood Transfusion Researchers have announced today that they'll soon start human trials of a cancer fighting method that uses blood from people who may be naturally cancer resistant. As this ScienCentral News video explains, for a decade the researchers have studied how this works in mice, and now they've received federal approval to try it in people. Researchers have announced today that they'll soon start human trials of a cancer fighting method that uses blood from people who may be naturally cancer resistant. As this ScienCentral News video explains, for a decade the researchers have studied how this works in mice, and now they've received federal approval to try it in people. ScienCentral ScienCentral blood cancer health medicine science transfusion tumors video nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Melting Glaciers Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 114

It's "chilling" detective work as scientists try to figure out the mystery of exactly how global warming is causing Greenland's glaciers to speed up on their way to the sea. As this ScienCentral News report explains, however, the leading suspect in this case has been cleared...mostly.

]]> climateenvironmentglacierglobalgreenlandicelakemeltingoceanwarming http://revver.com/video/1097106/melting-glaciers/ http://revver.com/watch/1097106 Melting Glaciers It's "chilling" detective work as scientists try to figure out the mystery of exactly how global warming is causing Greenland's glaciers to speed up on their way to the sea. As this ScienCentral News report explains, however, the leading suspect in this case has been cleared...mostly. It's "chilling" detective work as scientists try to figure out the mystery of exactly how global warming is causing Greenland's glaciers to speed up on their way to the sea. As this ScienCentral News report explains, however, the leading suspect in this case has been cleared...mostly. ScienCentral ScienCentral climate environment glacier global greenland ice lake melting ocean warming nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Immunity Boost Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 102

Amid the news of a $23-million court settlement by the makers of Airborne (a supplement that's earned hundreds of millions of dollars in sales with the claim that it boosts the immune system) biomedical engineers are publishing research on a powder that could turn out to be the real thing. As this ScienCentral News video explains, the new powder could first be used to help fight cancer.

]]> adoptiveaidscancerfluimmuneimmunotherapymedicinesystemt-cells http://revver.com/video/1097107/immunity-boost/ http://revver.com/watch/1097107 Immunity Boost Amid the news of a $23-million court settlement by the makers of Airborne (a supplement that's earned hundreds of millions of dollars in sales with the claim that it boosts the immune system) biomedical engineers are publishing research on a powder that could turn out to be the real thing. As this ScienCentral News video explains, the new powder could first be used to help fight cancer. Amid the news of a $23-million court settlement by the makers of Airborne (a supplement that's earned hundreds of millions of dollars in sales with the claim that it boosts the immune system) biomedical engineers are publishing research on a powder that could turn out to be the real thing. As this ScienCentral News video explains, the new powder could first be used to help fight cancer. ScienCentral ScienCentral adoptive aids cancer flu immune immunotherapy medicine system t-cells nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Magnetic Brain Boost Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 107

Whether it's hitting the books for exams or extreme situations like combat, lack of sleep often comes at times when we need to perform at our best. Now, as this ScienCentral News video reports, brain researchers studying how sleep deprivation impairs memory have found a potential remedy.

]]> braindementiadeprivationexhaustionmagneticmemorysleepstimluationtmstranscranial http://revver.com/video/1097109/magnetic-brain-boost/ http://revver.com/watch/1097109 Magnetic Brain Boost Whether it's hitting the books for exams or extreme situations like combat, lack of sleep often comes at times when we need to perform at our best. Now, as this ScienCentral News video reports, brain researchers studying how sleep deprivation impairs memory have found a potential remedy. Whether it's hitting the books for exams or extreme situations like combat, lack of sleep often comes at times when we need to perform at our best. Now, as this ScienCentral News video reports, brain researchers studying how sleep deprivation impairs memory have found a potential remedy. ScienCentral ScienCentral brain dementia deprivation exhaustion magnetic memory sleep stimluation tms transcranial nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ 3-D Microscope Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 110

Biologists can now observe the workings inside our cells in full color, 3-D and soon to be real-time. As this ScienCentral News video explains, scientists have invented a way to trick a light microscope into revealing more details than ever before seen.

]]> biologycellelectronlightmicroscopenucleuswavelength http://revver.com/video/1097110/3-d-microscope/ http://revver.com/watch/1097110 3-D Microscope Biologists can now observe the workings inside our cells in full color, 3-D and soon to be real-time. As this ScienCentral News video explains, scientists have invented a way to trick a light microscope into revealing more details than ever before seen. Biologists can now observe the workings inside our cells in full color, 3-D and soon to be real-time. As this ScienCentral News video explains, scientists have invented a way to trick a light microscope into revealing more details than ever before seen. ScienCentral ScienCentral biology cell electron light microscope nucleus wavelength nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Jet Stream Shifting Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 110

One of the main drivers of world's weather is moving due to climate change. As this ScienCentral News report explains, scientists are finding that the jet stream, that river of air that pushes storms across the country, is moving towards the north and south poles.

]]> atmospherechangeclimatecurrentglobaljetlightningoceanstormstreamwarmingweatherwind http://revver.com/video/1097111/jet-stream-shifting/ http://revver.com/watch/1097111 Jet Stream Shifting One of the main drivers of world's weather is moving due to climate change. As this ScienCentral News report explains, scientists are finding that the jet stream, that river of air that pushes storms across the country, is moving towards the north and south poles. One of the main drivers of world's weather is moving due to climate change. As this ScienCentral News report explains, scientists are finding that the jet stream, that river of air that pushes storms across the country, is moving towards the north and south poles. ScienCentral ScienCentral atmosphere change climate current global jet lightning ocean storm stream warming weather wind nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Hearing Hurricanes Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 116

Could future hurricane forecasters learn about hurricane intensity simply by listening to them? As this ScienCentral report explains, researchers are finding a way to match the sound below the ocean's surface to the hurricane's wind speed.

]]> hurricanekatrinanoaasatellitestormweatherwind http://revver.com/video/1097112/hearing-hurricanes/ http://revver.com/watch/1097112 Hearing Hurricanes Could future hurricane forecasters learn about hurricane intensity simply by listening to them? As this ScienCentral report explains, researchers are finding a way to match the sound below the ocean's surface to the hurricane's wind speed. Could future hurricane forecasters learn about hurricane intensity simply by listening to them? As this ScienCentral report explains, researchers are finding a way to match the sound below the ocean's surface to the hurricane's wind speed. ScienCentral ScienCentral hurricane katrina noaa satellite storm weather wind nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Storms and Warming Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 112

Researchers studying the expected impact of global warming say many parts of the United States will see more thunderstorms as a result. As this ScienCentral video explains, they spotted an increase in the number of days with the conditions necessary to create big storms.

]]> changeclimatecomputerglobalmodelstormsthunderstormswarming http://revver.com/video/1097113/storms-and-warming/ http://revver.com/watch/1097113 Storms and Warming Researchers studying the expected impact of global warming say many parts of the United States will see more thunderstorms as a result. As this ScienCentral video explains, they spotted an increase in the number of days with the conditions necessary to create big storms. Researchers studying the expected impact of global warming say many parts of the United States will see more thunderstorms as a result. As this ScienCentral video explains, they spotted an increase in the number of days with the conditions necessary to create big storms. ScienCentral ScienCentral change climate computer global model storms thunderstorms warming nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Obesity and Infection Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 108

Scientists have found yet another reason for you to shed those excess pounds. As this ScienCentral video explains, researchers working with mice have found that obesity lessens the body's ability to handle infection.

]]> dietfatimmuneinfectionlossobesityweight http://revver.com/video/1097115/obesity-and-infection/ http://revver.com/watch/1097115 Obesity and Infection Scientists have found yet another reason for you to shed those excess pounds. As this ScienCentral video explains, researchers working with mice have found that obesity lessens the body's ability to handle infection. Scientists have found yet another reason for you to shed those excess pounds. As this ScienCentral video explains, researchers working with mice have found that obesity lessens the body's ability to handle infection. ScienCentral ScienCentral diet fat immune infection loss obesity weight nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Diabetes Brake Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 115

Researchers have discovered how to stop a critical braking mechanism that makes obese people non-responsive to insulin, leading to diabetes. As this ScienCentral News video reports, finding this molecular brake gives hope for a new generation of diabetes drugs.

]]> diabetesdrugsfatinsulinobesity http://revver.com/video/1097116/diabetes-brake/ http://revver.com/watch/1097116 Diabetes Brake Researchers have discovered how to stop a critical braking mechanism that makes obese people non-responsive to insulin, leading to diabetes. As this ScienCentral News video reports, finding this molecular brake gives hope for a new generation of diabetes drugs. Researchers have discovered how to stop a critical braking mechanism that makes obese people non-responsive to insulin, leading to diabetes. As this ScienCentral News video reports, finding this molecular brake gives hope for a new generation of diabetes drugs. ScienCentral ScienCentral diabetes drugs fat insulin obesity nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Addicted to Mom Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 99

Researchers have confirmed what a lot of you mothers out there already know: some infants just seem programmed to need their mothers more. As this ScienCentral News video explains, scientists have found a genetic reason why some baby monkeys are more attached to mom, and that the attachment is more like an addiction.

]]> addictionattachmentmommonkeymotherwean http://revver.com/video/1097117/addicted-to-mom/ http://revver.com/watch/1097117 Addicted to Mom Researchers have confirmed what a lot of you mothers out there already know: some infants just seem programmed to need their mothers more. As this ScienCentral News video explains, scientists have found a genetic reason why some baby monkeys are more attached to mom, and that the attachment is more like an addiction. Researchers have confirmed what a lot of you mothers out there already know: some infants just seem programmed to need their mothers more. As this ScienCentral News video explains, scientists have found a genetic reason why some baby monkeys are more attached to mom, and that the attachment is more like an addiction. ScienCentral ScienCentral addiction attachment mom monkey mother wean nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Sweet Tooth Gene Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 99

"You are what you eat" may be more true than we think. Researchers have linked a specific gene difference to consuming more sugary foods. And as this ScienCentral News video explains, they even uncovered how the sweet tooth gene likely affects sugar intake.

]]> diabetesdietfoodgenegeneticshealthmutationobesitypancreassugarsweet http://revver.com/video/1097118/sweet-tooth-gene/ http://revver.com/watch/1097118 Sweet Tooth Gene "You are what you eat" may be more true than we think. Researchers have linked a specific gene difference to consuming more sugary foods. And as this ScienCentral News video explains, they even uncovered how the sweet tooth gene likely affects sugar intake. "You are what you eat" may be more true than we think. Researchers have linked a specific gene difference to consuming more sugary foods. And as this ScienCentral News video explains, they even uncovered how the sweet tooth gene likely affects sugar intake. ScienCentral ScienCentral diabetes diet food gene genetics health mutation obesity pancreas sugar sweet nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Cats, Kids and Asthma Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 111

Are cats good at preventing asthma? That's the finding of a group of scientists studying childhood allergies in houses with and without cats, as this ScienCentral video reports.

]]> allergiesallergyasthmacatschildrenexposureimmuneprotection http://revver.com/video/1097119/cats-kids-and-asthma/ http://revver.com/watch/1097119 Cats, Kids and Asthma Are cats good at preventing asthma? That's the finding of a group of scientists studying childhood allergies in houses with and without cats, as this ScienCentral video reports. Are cats good at preventing asthma? That's the finding of a group of scientists studying childhood allergies in houses with and without cats, as this ScienCentral video reports. ScienCentral ScienCentral allergies allergy asthma cats children exposure immune protection nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Diabetes Surgery Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 123

It may be the closest known thing to a cure for type 2 diabetes: gastric bypass surgery, currently done only for major weight loss. But one surgeon hopes to prove that a similar surgery could help non-obese diabetics. In this ScienCentral News video report, meet a diabetes patient who's determined to have the surgery.

]]> bariatricdiabetesgastriclossobesityoverweightsurgeryweight http://revver.com/video/1097121/diabetes-surgery/ http://revver.com/watch/1097121 Diabetes Surgery It may be the closest known thing to a cure for type 2 diabetes: gastric bypass surgery, currently done only for major weight loss. But one surgeon hopes to prove that a similar surgery could help non-obese diabetics. In this ScienCentral News video report, meet a diabetes patient who's determined to have the surgery. It may be the closest known thing to a cure for type 2 diabetes: gastric bypass surgery, currently done only for major weight loss. But one surgeon hopes to prove that a similar surgery could help non-obese diabetics. In this ScienCentral News video report, meet a diabetes patient who's determined to have the surgery. ScienCentral ScienCentral bariatric diabetes gastric loss obesity overweight surgery weight nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Seeing Hungry Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 92

Why does food look more appealing when you are hungry? Scientists are finding that the same chemical in your stomach that causes hunger also changes how your brain perceives food, as this ScienCentral News video explains.

]]> amygdalabrainfmrifoodghrelinhungerinsulaobesityperceptionrewardvision http://revver.com/video/1097125/seeing-hungry/ http://revver.com/watch/1097125 Seeing Hungry Why does food look more appealing when you are hungry? Scientists are finding that the same chemical in your stomach that causes hunger also changes how your brain perceives food, as this ScienCentral News video explains. Why does food look more appealing when you are hungry? Scientists are finding that the same chemical in your stomach that causes hunger also changes how your brain perceives food, as this ScienCentral News video explains. ScienCentral ScienCentral amygdala brain fmri food ghrelin hunger insula obesity perception reward vision nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Robot Dog Therapy Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 115

Do you crave the companionship of a pet, but can't be dogged by the commitment? New research suggests that robotic dogs can give you some of the same benefits you'd get from the real thing. This ScienCentral News video explains.

]]> agingaiboanimalcompaniondogelderlyfriendshiphappinesslonelinesspetpsychologyrobottechnology http://revver.com/video/1097127/robot-dog-therapy/ http://revver.com/watch/1097127 Robot Dog Therapy Do you crave the companionship of a pet, but can't be dogged by the commitment? New research suggests that robotic dogs can give you some of the same benefits you'd get from the real thing. This ScienCentral News video explains. Do you crave the companionship of a pet, but can't be dogged by the commitment? New research suggests that robotic dogs can give you some of the same benefits you'd get from the real thing. This ScienCentral News video explains. ScienCentral ScienCentral aging aibo animal companion dog elderly friendship happiness loneliness pet psychology robot technology nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Belly Fat and Long Life Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 98

Can surgically removing belly fat lengthen your life? As this ScienCentral News video reports, researchers working with rats have found that it does.

]]> bellydietfathealthheartliposuctionobesitysurgery http://revver.com/video/1097128/belly-fat-and-long-life/ http://revver.com/watch/1097128 Belly Fat and Long Life Can surgically removing belly fat lengthen your life? As this ScienCentral News video reports, researchers working with rats have found that it does. Can surgically removing belly fat lengthen your life? As this ScienCentral News video reports, researchers working with rats have found that it does. ScienCentral ScienCentral belly diet fat health heart liposuction obesity surgery nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Enjoying Aggression Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 102

Is aggressive behavior something that sometimes happens just because we like it? As this ScienCentral news report explains, research done on mice suggests we enjoy it the same way we enjoy other addicting activities.

]]> addictionaggressionbrainpsychology http://revver.com/video/1097129/enjoying-aggression/ http://revver.com/watch/1097129 Enjoying Aggression Is aggressive behavior something that sometimes happens just because we like it? As this ScienCentral news report explains, research done on mice suggests we enjoy it the same way we enjoy other addicting activities. Is aggressive behavior something that sometimes happens just because we like it? As this ScienCentral news report explains, research done on mice suggests we enjoy it the same way we enjoy other addicting activities. ScienCentral ScienCentral addiction aggression brain psychology nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ The Stud Effect Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 108

Is a woman's choice of valentine really a choice? As this ScienCentral news video explains, researchers studying mice have found that alpha males can trigger growth of new brain cells in females that make them want only alpha males.

]]> alphaeffectlovemalepsychologystud http://revver.com/video/1097130/the-stud-effect/ http://revver.com/watch/1097130 The Stud Effect Is a woman's choice of valentine really a choice? As this ScienCentral news video explains, researchers studying mice have found that alpha males can trigger growth of new brain cells in females that make them want only alpha males. Is a woman's choice of valentine really a choice? As this ScienCentral news video explains, researchers studying mice have found that alpha males can trigger growth of new brain cells in females that make them want only alpha males. ScienCentral ScienCentral alpha effect love male psychology stud nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Better (Rewriteable) Holograms Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 112

Live, 3D holographic movies are now a big step closer. As this ScienCentral News video explains, researchers are developing them using a new material that makes holograms rewritable.

]]> hologramholographicholographyvideo http://revver.com/video/1097131/better-rewriteable-holograms/ http://revver.com/watch/1097131 Better (Rewriteable) Holograms Live, 3D holographic movies are now a big step closer. As this ScienCentral News video explains, researchers are developing them using a new material that makes holograms rewritable. Live, 3D holographic movies are now a big step closer. As this ScienCentral News video explains, researchers are developing them using a new material that makes holograms rewritable. ScienCentral ScienCentral hologram holographic holography video nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Nano Pollution and Health Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 116

Scientists find that air pollution is even worse for you than previously thought. As this ScienCentral News video explains, new research shows how tiny particles from vehicle emissions can cause heart disease and other problems.

]]> atherosclerosisdiseaseemissionsepaheartmonitoringnanoparticulateplaquepollutionroadwayultrafine http://revver.com/video/1097133/nano-pollution-and-health/ http://revver.com/watch/1097133 Nano Pollution and Health Scientists find that air pollution is even worse for you than previously thought. As this ScienCentral News video explains, new research shows how tiny particles from vehicle emissions can cause heart disease and other problems. Scientists find that air pollution is even worse for you than previously thought. As this ScienCentral News video explains, new research shows how tiny particles from vehicle emissions can cause heart disease and other problems. ScienCentral ScienCentral atherosclerosis disease emissions epa heart monitoring nano particulate plaque pollution roadway ultrafine nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Squid Beaks Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 104

Think of Edward Scissorhands with a body made out of Jello. How would he not cut himself to pieces? Researchers have long asked that question about squid soft squishy creatures with hard, sharp beaks. As this ScienCentral News video explains, the answers could lead to a useful new class of materials.

]]> materials ocean prosthetics esquid http://revver.com/video/1097134/squid-beaks/ http://revver.com/watch/1097134 Squid Beaks Think of Edward Scissorhands with a body made out of Jello. How would he not cut himself to pieces? Researchers have long asked that question about squid soft squishy creatures with hard, sharp beaks. As this ScienCentral News video explains, the answers could lead to a useful new class of materials. Think of Edward Scissorhands with a body made out of Jello. How would he not cut himself to pieces? Researchers have long asked that question about squid soft squishy creatures with hard, sharp beaks. As this ScienCentral News video explains, the answers could lead to a useful new class of materials. ScienCentral ScienCentral materials ocean prosthetics e squid nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Pain Gene Therapy Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 105

Researchers are developing a long-lasting way to relieve chronic pain with a single injection. As this ScienCentral video explains, the work so far has been done in rats, but researchers hope to one day offer it as an alternative when even strong drugs like morphine fail.

]]> braincancerchronicgenemorphineneuronpaintherapy http://revver.com/video/1097135/pain-gene-therapy/ http://revver.com/watch/1097135 Pain Gene Therapy Researchers are developing a long-lasting way to relieve chronic pain with a single injection. As this ScienCentral video explains, the work so far has been done in rats, but researchers hope to one day offer it as an alternative when even strong drugs like morphine fail. Researchers are developing a long-lasting way to relieve chronic pain with a single injection. As this ScienCentral video explains, the work so far has been done in rats, but researchers hope to one day offer it as an alternative when even strong drugs like morphine fail. ScienCentral ScienCentral brain cancer chronic gene morphine neuron pain therapy nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Anorexia and Reward Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 97

New research suggests that the brains of former anorexics have a hard time telling the difference between winning and losing. This ScienCentral News video reports one of two stories we have on anorexia and the brain, during National Eating Disorders Awareness Week.

]]> anorexiabraindisordereatingreward http://revver.com/video/1097136/anorexia-and-reward/ http://revver.com/watch/1097136 Anorexia and Reward New research suggests that the brains of former anorexics have a hard time telling the difference between winning and losing. This ScienCentral News video reports one of two stories we have on anorexia and the brain, during National Eating Disorders Awareness Week. New research suggests that the brains of former anorexics have a hard time telling the difference between winning and losing. This ScienCentral News video reports one of two stories we have on anorexia and the brain, during National Eating Disorders Awareness Week. ScienCentral ScienCentral anorexia brain disorder eating reward nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Autism and Virtual Pals Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 121

Kids with autism have trouble listening and responding, but they may get some help from a virtual friend. As this ScienCentral News video explains, technology could help previously isolated kids make connections in the real world.

]]> aspergerautismchildrencommunicationlearningvirtual http://revver.com/video/1097138/autism-and-virtual-pals/ http://revver.com/watch/1097138 Autism and Virtual Pals Kids with autism have trouble listening and responding, but they may get some help from a virtual friend. As this ScienCentral News video explains, technology could help previously isolated kids make connections in the real world. Kids with autism have trouble listening and responding, but they may get some help from a virtual friend. As this ScienCentral News video explains, technology could help previously isolated kids make connections in the real world. ScienCentral ScienCentral asperger autism children communication learning virtual nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ No Water Grass Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 104

Worried about how much water you use, but love your healthy-looking yard? New research into how plants conserve water may help scientists to engineer a less thirsty lawn. This ScienCentral News video explains.

]]> conservegrasslawnsprinklerwater http://revver.com/video/1097139/no-water-grass/ http://revver.com/watch/1097139 No Water Grass Worried about how much water you use, but love your healthy-looking yard? New research into how plants conserve water may help scientists to engineer a less thirsty lawn. This ScienCentral News video explains. Worried about how much water you use, but love your healthy-looking yard? New research into how plants conserve water may help scientists to engineer a less thirsty lawn. This ScienCentral News video explains. ScienCentral ScienCentral conserve grass lawn sprinkler water nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Diet Food Backfire Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 114

Trying to cut calories at that fourth-of-July barbecue? Diet foods and drinks may not be the answer. This ScienCentral News video explains why new research shows foods with no calories just aren't as satisfying.

]]> braindietfoodobesitysodasplendasucralosesweetenerweight http://revver.com/video/1097140/diet-food-backfire/ http://revver.com/watch/1097140 Diet Food Backfire Trying to cut calories at that fourth-of-July barbecue? Diet foods and drinks may not be the answer. This ScienCentral News video explains why new research shows foods with no calories just aren't as satisfying. Trying to cut calories at that fourth-of-July barbecue? Diet foods and drinks may not be the answer. This ScienCentral News video explains why new research shows foods with no calories just aren't as satisfying. ScienCentral ScienCentral brain diet food obesity soda splenda sucralose sweetener weight nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Virtual Alcohol Control Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 113

Scientists are using virtual reality to help alcoholics cope with situations that might get them in trouble. This ScienCentral News video explains.

]]> alcoholalcoholicbeerdrinkliquorrealityrecoverysimulationtemptationvirtualwine http://revver.com/video/1097142/virtual-alcohol-control/ http://revver.com/watch/1097142 Virtual Alcohol Control Scientists are using virtual reality to help alcoholics cope with situations that might get them in trouble. This ScienCentral News video explains. Scientists are using virtual reality to help alcoholics cope with situations that might get them in trouble. This ScienCentral News video explains. ScienCentral ScienCentral alcohol alcoholic beer drink liquor reality recovery simulation temptation virtual wine nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Candy For Cavities Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 97

A lollipop that prevents cavities? If you haven't already seen them in your child's dentist's office, you may soon. As this ScienCentral News video explains, researchers pored over Chinese herbal remedies and found the answer lay in licorice.

]]> antibacterialbacteriacariescavitiesdecaylollipopmutanstooth http://revver.com/video/1097143/candy-for-cavities/ http://revver.com/watch/1097143 Candy For Cavities A lollipop that prevents cavities? If you haven't already seen them in your child's dentist's office, you may soon. As this ScienCentral News video explains, researchers pored over Chinese herbal remedies and found the answer lay in licorice. A lollipop that prevents cavities? If you haven't already seen them in your child's dentist's office, you may soon. As this ScienCentral News video explains, researchers pored over Chinese herbal remedies and found the answer lay in licorice. ScienCentral ScienCentral antibacterial bacteria caries cavities decay lollipop mutans tooth nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Nicotine Like Heroin Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 106

Scientists studying how the brain reacts to smoking are finding more evidence that nicotine and heroin have similar effects. This ScienCentral News video reports that researchers at University of Chicago have found a part of the brain that responds to smoking and heroin in much the same way.

]]> addictionbraindopaminedrugheroinneurotransmitternicotineregionsmoking http://revver.com/video/1097145/nicotine-like-heroin/ http://revver.com/watch/1097145 Nicotine Like Heroin Scientists studying how the brain reacts to smoking are finding more evidence that nicotine and heroin have similar effects. This ScienCentral News video reports that researchers at University of Chicago have found a part of the brain that responds to smoking and heroin in much the same way. Scientists studying how the brain reacts to smoking are finding more evidence that nicotine and heroin have similar effects. This ScienCentral News video reports that researchers at University of Chicago have found a part of the brain that responds to smoking and heroin in much the same way. ScienCentral ScienCentral addiction brain dopamine drug heroin neurotransmitter nicotine region smoking nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Smoker Brain Error Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 106

Why are addicts so bad at thinking about tomorrow, beyond viewing it as a better time to quit than today? New research shows smokers' brains ignore signals about "what might happen." As this ScienCentral News video explains, the study looked at smokers' choices about investing, not about their habit.

]]> braindecisionsmarketquittingsmoking http://revver.com/video/1097146/smoker-brain-error/ http://revver.com/watch/1097146 Smoker Brain Error Why are addicts so bad at thinking about tomorrow, beyond viewing it as a better time to quit than today? New research shows smokers' brains ignore signals about "what might happen." As this ScienCentral News video explains, the study looked at smokers' choices about investing, not about their habit. Why are addicts so bad at thinking about tomorrow, beyond viewing it as a better time to quit than today? New research shows smokers' brains ignore signals about "what might happen." As this ScienCentral News video explains, the study looked at smokers' choices about investing, not about their habit. ScienCentral ScienCentral brain decisions market quitting smoking nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Schizophrenia Gene Puzzle Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 119

Scientists are trying to decode the genetic causes of schizophrenia. But as this ScienCentral News video explains, new research suggests that nearly every person with the illness has a different genetic defect.

]]> diseasednagenegeneticsillnessmentalmutationpsychologyschizophrenia http://revver.com/video/1097148/schizophrenia-gene-puzzle/ http://revver.com/watch/1097148 Schizophrenia Gene Puzzle Scientists are trying to decode the genetic causes of schizophrenia. But as this ScienCentral News video explains, new research suggests that nearly every person with the illness has a different genetic defect. Scientists are trying to decode the genetic causes of schizophrenia. But as this ScienCentral News video explains, new research suggests that nearly every person with the illness has a different genetic defect. ScienCentral ScienCentral disease dna gene genetics illness mental mutation psychology schizophrenia nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Anorexia and Taste Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 102

Research on brain scans reveals that women with anorexia may experience taste differently than others. This ScienCentral News Video reports one of two stories we have on anorexia and the brain, during National Eating Disorders Awareness Week.

]]> anorexiabraindisordereatingtaste http://revver.com/video/1097149/anorexia-and-taste/ http://revver.com/watch/1097149 Anorexia and Taste Research on brain scans reveals that women with anorexia may experience taste differently than others. This ScienCentral News Video reports one of two stories we have on anorexia and the brain, during National Eating Disorders Awareness Week. Research on brain scans reveals that women with anorexia may experience taste differently than others. This ScienCentral News Video reports one of two stories we have on anorexia and the brain, during National Eating Disorders Awareness Week. ScienCentral ScienCentral anorexia brain disorder eating taste nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Magneto Boy Wed, 13 Aug 2008 05:54:13 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 05:54:13 -0800
Duration: 119

In the upcoming movie "Be Kind, Rewind," Jack Black plays a man who is magnetized and erases an entire store-full of video tapes. But can people really be "magnetic?" In this ScienCentral News video, meet a boy who calls himself "Magneto Man," and has a reputation for making computers go wild.

]]> beblackelectricityjackkindmagnetizedrewindstatic http://revver.com/video/1097055/magneto-boy/ http://revver.com/watch/1097055 Magneto Boy In the upcoming movie "Be Kind, Rewind," Jack Black plays a man who is magnetized and erases an entire store-full of video tapes. But can people really be "magnetic?" In this ScienCentral News video, meet a boy who calls himself "Magneto Man," and has a reputation for making computers go wild. In the upcoming movie "Be Kind, Rewind," Jack Black plays a man who is magnetized and erases an entire store-full of video tapes. But can people really be "magnetic?" In this ScienCentral News video, meet a boy who calls himself "Magneto Man," and has a reputation for making computers go wild. ScienCentral ScienCentral be black electricity jack kind magnetized rewind static nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Gasoline From Trees Wed, 13 Aug 2008 05:54:13 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 05:54:13 -0800
Duration: 101

Scientists have found a way to convert wood fiber from trees into fuel for your car. As this ScienCentral News report explains, the surprisingly simple process might put biofuels in your car's tank without using the world's food supply.

]]> biofuelbiomassenergyethanolfuelgasgasolinegreenoil http://revver.com/video/1097056/gasoline-from-trees/ http://revver.com/watch/1097056 Gasoline From Trees Scientists have found a way to convert wood fiber from trees into fuel for your car. As this ScienCentral News report explains, the surprisingly simple process might put biofuels in your car's tank without using the world's food supply. Scientists have found a way to convert wood fiber from trees into fuel for your car. As this ScienCentral News report explains, the surprisingly simple process might put biofuels in your car's tank without using the world's food supply. ScienCentral ScienCentral biofuel biomass energy ethanol fuel gas gasoline green oil nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Twin DNA Differences Wed, 13 Aug 2008 05:54:13 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 05:54:13 -0800
Duration: 108

Geneticists are discovering that identical twins don't have identical DNA. As this ScienCentral News video explains, this surprising research could help scientists better understand genetic diseases in the rest of us.

]]> diseasesdnageneticsmicroarraytwins http://revver.com/video/1097057/twin-dna-differences/ http://revver.com/watch/1097057 Twin DNA Differences Geneticists are discovering that identical twins don't have identical DNA. As this ScienCentral News video explains, this surprising research could help scientists better understand genetic diseases in the rest of us. Geneticists are discovering that identical twins don't have identical DNA. As this ScienCentral News video explains, this surprising research could help scientists better understand genetic diseases in the rest of us. ScienCentral ScienCentral diseases dna genetics microarray twins nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/