Videos by ScienCentral Videos by ScienCentral http://revver.com/u/ScienCentral/ http://revver.com webmaster@revver.com CO2 and Plant Pests Wed, 03 Sep 2008 17:55:00 -0800

Author: ScienCentral
Added: Wed, 03 Sep 2008 17:55:00 -0800
Duration: 110

Researchers are finding that rising levels of carbon dioxide in the air might be bad for our gardens and food prices, even though plants need CO2 to breathe. As this ScienCentral News video explains, research is showing that too much CO2 can make at least one major crop more vulnerable to pests.

]]> beetlesbugscarbon dioxideclimateco2environmentevan deluciafoodgardensgasgreenhouseinsectsjapanese beetlespestsplantssoybean http://revver.com/video/1149840/co2-and-plant-pests/ http://revver.com/watch/1149840 CO2 and Plant Pests Researchers are finding that rising levels of carbon dioxide in the air might be bad for our gardens and food prices, even though plants need CO2 to breathe. As this ScienCentral News video explains, research is showing that too much CO2 can make at least one major crop more vulnerable to pests. Researchers are finding that rising levels of carbon dioxide in the air might be bad for our gardens and food prices, even though plants need CO2 to breathe. As this ScienCentral News video explains, research is showing that too much CO2 can make at least one major crop more vulnerable to pests. ScienCentral ScienCentral beetles bugs carbon dioxide climate co2 environment evan delucia food gardens gas greenhouse insects japanese beetles pests plants soybean nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Fast Fat Mon, 01 Sep 2008 20:35:35 -0800

Author: ScienCentral
Added: Mon, 01 Sep 2008 20:35:35 -0800
Duration: 113

When it comes to making fat, not all sugars are created equal. As this ScienCentral News video reports, scientists are finding that fructose could be making us fatter, faster.

]]> carbohydratescorn syrupdietelizabeth parksfastfatfatty acidfructoseglucosehealthhigh fructose corn syrupjunk foodlose weight fastmarion nestleobesityoverweightsucrosesugarweight gainweight loss http://revver.com/video/1140499/fast-fat/ http://revver.com/watch/1140499 Fast Fat When it comes to making fat, not all sugars are created equal. As this ScienCentral News video reports, scientists are finding that fructose could be making us fatter, faster. When it comes to making fat, not all sugars are created equal. As this ScienCentral News video reports, scientists are finding that fructose could be making us fatter, faster. ScienCentral ScienCentral carbohydrates corn syrup diet elizabeth parks fast fat fatty acid fructose glucose health high fructose corn syrup junk food lose weight fast marion nestle obesity overweight sucrose sugar weight gain weight loss nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Organ Repair Fri, 29 Aug 2008 12:35:18 -0800

Author: ScienCentral
Added: Fri, 29 Aug 2008 12:35:18 -0800
Duration: 103

For the first time, researchers have prevented the typical age-related decline in a whole organ, allowing old mice to have livers that keep working like when they were young. This ScienCentral News video reports on a strategy that researchers think could lead to treatments for age-related decline in other organs, such as the brain.

]]> ageage reversalalbert einstein college of medalzheimer'sana maria cuervobraincellcong zhanggarbagegenegene therapygeneticsliverlysosomemicemouseorgan ageorganelleorgansoxidizationparkinson'sproteinrustskinwrinkles http://revver.com/video/1139651/organ-repair/ http://revver.com/watch/1139651 Organ Repair For the first time, researchers have prevented the typical age-related decline in a whole organ, allowing old mice to have livers that keep working like when they were young. This ScienCentral News video reports on a strategy that researchers think could lead to treatments for age-related decline in other organs, such as the brain. For the first time, researchers have prevented the typical age-related decline in a whole organ, allowing old mice to have livers that keep working like when they were young. This ScienCentral News video reports on a strategy that researchers think could lead to treatments for age-related decline in other organs, such as the brain. ScienCentral ScienCentral age age reversal albert einstein college of med alzheimer's ana maria cuervo brain cell cong zhang garbage gene gene therapy genetics liver lysosome mice mouse organ age organelle organs oxidization parkinson's protein rust skin wrinkles nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Acid Oceans Thu, 28 Aug 2008 08:35:08 -0800

Author: ScienCentral
Added: Thu, 28 Aug 2008 08:35:08 -0800
Duration: 115

New research is showing that carbon dioxide is not only causing global warming, but it's also causing sea water to become more acidic. As this ScienCentral News video explains, the implications of this on underwater life is becoming a hot topic for everyone from scientists, to IMAX filmmakers.

]]> 3dacid oceansacidificationglobal warminghoward hallimaxunder the sea http://revver.com/video/1135155/acid-oceans/ http://revver.com/watch/1135155 Acid Oceans New research is showing that carbon dioxide is not only causing global warming, but it's also causing sea water to become more acidic. As this ScienCentral News video explains, the implications of this on underwater life is becoming a hot topic for everyone from scientists, to IMAX filmmakers. New research is showing that carbon dioxide is not only causing global warming, but it's also causing sea water to become more acidic. As this ScienCentral News video explains, the implications of this on underwater life is becoming a hot topic for everyone from scientists, to IMAX filmmakers. ScienCentral ScienCentral 3d acid oceans acidification global warming howard hall imax under the sea nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Street Corner Science with Leon Lederman Part 2 Wed, 27 Aug 2008 08:36:23 -0800

Author: ScienCentral
Added: Wed, 27 Aug 2008 08:36:23 -0800
Duration: 236

Part 2 of 2. ScienCentral is taking science to the people in its latest installment of "Street Corner Science", in which a film crew and a renowned scientist are plunked down on a busy city street corner, and an impromptu Q&A session with the public ensues!

]]> cernfusiongod particlehiggs bosoninterviewiterleon ledermanlhcnobelnobel prizenuclear forceparticle physicsphysicistphysicsq&aquestionssciencesingularityspacestreet corner sciencestrong forcetime travel http://revver.com/video/1133535/street-corner-science-with-leon-lederman-part-2/ http://revver.com/watch/1133535 Street Corner Science with Leon Lederman Part 2 Part 2 of 2. ScienCentral is taking science to the people in its latest installment of "Street Corner Science", in which a film crew and a renowned scientist are plunked down on a busy city street corner, and an impromptu Q&A session with the public ensues! Part 2 of 2. ScienCentral is taking science to the people in its latest installment of "Street Corner Science", in which a film crew and a renowned scientist are plunked down on a busy city street corner, and an impromptu Q&A session with the public ensues! ScienCentral ScienCentral cern fusion god particle higgs boson interview iter leon lederman lhc nobel nobel prize nuclear force particle physics physicist physics q&a questions science singularity space street corner science strong force time travel nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bat Wind Deaths Mon, 25 Aug 2008 23:55:24 -0800

Author: ScienCentral
Added: Mon, 25 Aug 2008 23:55:24 -0800
Duration: 103

The big knock on wind turbines has been that they're dangerous to birds. But researchers have found that they actually kill more bats, and the reason why has been a mystery--until now. As this ScienCentral News video explains, a study published today finds the bats are actually drowning in mid-air.

]]> batbatsdrowningdying batsenergyerin baerwaldgreenkenny breuerlungspressuresharon swartzthe bendsturbinewindmill http://revver.com/video/1130947/bat-wind-deaths/ http://revver.com/watch/1130947 Bat Wind Deaths The big knock on wind turbines has been that they're dangerous to birds. But researchers have found that they actually kill more bats, and the reason why has been a mystery--until now. As this ScienCentral News video explains, a study published today finds the bats are actually drowning in mid-air. The big knock on wind turbines has been that they're dangerous to birds. But researchers have found that they actually kill more bats, and the reason why has been a mystery--until now. As this ScienCentral News video explains, a study published today finds the bats are actually drowning in mid-air. ScienCentral ScienCentral bat bats drowning dying bats energy erin baerwald green kenny breuer lungs pressure sharon swartz the bends turbine windmill nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Street Corner Science with Leon Lederman Thu, 21 Aug 2008 19:55:05 -0800

Author: ScienCentral
Added: Thu, 21 Aug 2008 19:55:05 -0800
Duration: 211

ScienCentral is taking science to the people in its first installment of "Street Corner Science", in which a film crew and a renowned scientist are plunked down on a busy city street corner, and an impromptu Q&A session with the public ensues!

]]> fusiongod particleinterviewleon ledermannobelnobel prizenuclear forcephysicistphysicsq&aquestionssciencesingularityspacestreet corner sciencestrong force http://revver.com/video/1123663/street-corner-science-with-leon-lederman/ http://revver.com/watch/1123663 Street Corner Science with Leon Lederman ScienCentral is taking science to the people in its first installment of "Street Corner Science", in which a film crew and a renowned scientist are plunked down on a busy city street corner, and an impromptu Q&A session with the public ensues! ScienCentral is taking science to the people in its first installment of "Street Corner Science", in which a film crew and a renowned scientist are plunked down on a busy city street corner, and an impromptu Q&A session with the public ensues! ScienCentral ScienCentral fusion god particle interview leon lederman nobel nobel prize nuclear force physicist physics q&a questions science singularity space street corner science strong force nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ HIV-Immune Cells Thu, 21 Aug 2008 19:55:05 -0800

Author: ScienCentral
Added: Thu, 21 Aug 2008 19:55:05 -0800
Duration: 108

Doctors are considering using a new technology to genetically modify AIDS patients' own cells to be resistant to HIV. As this ScienCentral News video explains, they're modeling the idea after rare individuals who are naturally immune to the AIDS virus.

]]> aidscarl junecat1690delta 32dnaelena perezgeneticshivimmuneimmunityimmunologynature biotechnologyphilip gregorysangamo biosciencesviruszfpzfpszinc finger proteins http://revver.com/video/1124087/hiv-immune-cells/ http://revver.com/watch/1124087 HIV-Immune Cells Doctors are considering using a new technology to genetically modify AIDS patients' own cells to be resistant to HIV. As this ScienCentral News video explains, they're modeling the idea after rare individuals who are naturally immune to the AIDS virus. Doctors are considering using a new technology to genetically modify AIDS patients' own cells to be resistant to HIV. As this ScienCentral News video explains, they're modeling the idea after rare individuals who are naturally immune to the AIDS virus. ScienCentral ScienCentral aids carl june cat1690 delta 32 dna elena perez genetics hiv immune immunity immunology nature biotechnology philip gregory sangamo biosciences virus zfp zfps zinc finger proteins nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Skin Cancer Smell Wed, 20 Aug 2008 09:54:57 -0800

Author: ScienCentral
Added: Wed, 20 Aug 2008 09:54:57 -0800
Duration: 93

Research announced today at a conference of the nation's leading chemists confirms that skin with cancer gives off a different odor than normal skin. ScienCentral reports on the first odor profile for skin cancer, and how it could lead to new cancer sniffing technology.

]]> skin cancer smell odor sniffin http://revver.com/video/1120733/skin-cancer-smell/ http://revver.com/watch/1120733 Skin Cancer Smell Research announced today at a conference of the nation's leading chemists confirms that skin with cancer gives off a different odor than normal skin. ScienCentral reports on the first odor profile for skin cancer, and how it could lead to new cancer sniffing technology. Research announced today at a conference of the nation's leading chemists confirms that skin with cancer gives off a different odor than normal skin. ScienCentral reports on the first odor profile for skin cancer, and how it could lead to new cancer sniffing technology. ScienCentral ScienCentral skin cancer smell odor sniffin nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Red Olympic Advantage Tue, 19 Aug 2008 11:19:46 -0800

Author: ScienCentral
Added: Tue, 19 Aug 2008 11:19:46 -0800
Duration: 112

Wondering who's got an edge in the next game or Olympic event? Here's a hint: watch out for the contenders in red.

]]> colorcompetitionjudgingmartial artsolympicpsychologyredscoringsportstaekwondounfair http://revver.com/video/1116937/red-olympic-advantage/ http://revver.com/watch/1116937 Red Olympic Advantage Wondering who's got an edge in the next game or Olympic event? Here's a hint: watch out for the contenders in red. Wondering who's got an edge in the next game or Olympic event? Here's a hint: watch out for the contenders in red. ScienCentral ScienCentral color competition judging martial arts olympic psychology red scoring sports taekwondo unfair nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Ask an Astronaut: Buzz Aldrin Part 2 Thu, 14 Aug 2008 23:54:21 -0800

Author: ScienCentral
Added: Thu, 14 Aug 2008 23:54:21 -0800
Duration: 230

In this Web exclusive, ScienCentral caught up with Buzz Aldrin at the premiere of his new animated 3D movie "Fly Me to the Moon," and then took to the streets to gather questions for the iconic astronaut. Part 2 of 2.

]]> apollo 11astronautbuzz aldrinfly me to the moonmoonq&aquestionsspace http://revver.com/video/1109889/ask-an-astronaut-buzz-aldrin-part-2/ http://revver.com/watch/1109889 Ask an Astronaut: Buzz Aldrin Part 2 In this Web exclusive, ScienCentral caught up with Buzz Aldrin at the premiere of his new animated 3D movie "Fly Me to the Moon," and then took to the streets to gather questions for the iconic astronaut. Part 2 of 2. In this Web exclusive, ScienCentral caught up with Buzz Aldrin at the premiere of his new animated 3D movie "Fly Me to the Moon," and then took to the streets to gather questions for the iconic astronaut. Part 2 of 2. ScienCentral ScienCentral apollo 11 astronaut buzz aldrin fly me to the moon moon q&a questions space nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ The Happening: Garden-variety Horror Wed, 13 Aug 2008 22:54:23 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 22:54:23 -0800
Duration: 165

Just when you thought it was safe to go back in the garden! Cast and crew of "The Happening" discuss challenges in making this enviro-horror film. For more, check out ScienCentral for the original story on toxic plants, "The Happening and Plant Science".

]]> m night shyamalan the happenin http://revver.com/video/1106761/the-happening-garden-variety-horror/ http://revver.com/watch/1106761 The Happening: Garden-variety Horror Just when you thought it was safe to go back in the garden! Cast and crew of "The Happening" discuss challenges in making this enviro-horror film. For more, check out ScienCentral for the original story on toxic plants, "The Happening and Plant Science". Just when you thought it was safe to go back in the garden! Cast and crew of "The Happening" discuss challenges in making this enviro-horror film. For more, check out ScienCentral for the original story on toxic plants, "The Happening and Plant Science". ScienCentral ScienCentral m night shyamalan the happenin nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bee Disease Spread Wed, 13 Aug 2008 22:54:23 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 22:54:23 -0800
Duration: 113

A new clue in the mysterious decline of bee populations: researchers have found that diseases are spreading from domesticated bumblebees to those in the wild. As this ScienCentral News video reports, that's leaving many species in danger of disappearing.

]]> beebumblebeedeclinediseasedomesticatedparasitespecies http://revver.com/video/1107309/bee-disease-spread/ http://revver.com/watch/1107309 Bee Disease Spread A new clue in the mysterious decline of bee populations: researchers have found that diseases are spreading from domesticated bumblebees to those in the wild. As this ScienCentral News video reports, that's leaving many species in danger of disappearing. A new clue in the mysterious decline of bee populations: researchers have found that diseases are spreading from domesticated bumblebees to those in the wild. As this ScienCentral News video reports, that's leaving many species in danger of disappearing. ScienCentral ScienCentral bee bumblebee decline disease domesticated parasite species nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Ask an Astronaut: Buzz Aldrin Part 1 Wed, 13 Aug 2008 13:54:19 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 13:54:19 -0800
Duration: 255

In this Web exclusive, ScienCentral caught up with Buzz Aldrin at the premiere of his new animated 3D movie "Fly Me to the Moon," and then took to the streets to gather questions for the iconic astronaut. Part 1 of 2.

]]> apollo 11 astronaut buzz aldri http://revver.com/video/1106448/ask-an-astronaut-buzz-aldrin-part-1/ http://revver.com/watch/1106448 Ask an Astronaut: Buzz Aldrin Part 1 In this Web exclusive, ScienCentral caught up with Buzz Aldrin at the premiere of his new animated 3D movie "Fly Me to the Moon," and then took to the streets to gather questions for the iconic astronaut. Part 1 of 2. In this Web exclusive, ScienCentral caught up with Buzz Aldrin at the premiere of his new animated 3D movie "Fly Me to the Moon," and then took to the streets to gather questions for the iconic astronaut. Part 1 of 2. ScienCentral ScienCentral apollo 11 astronaut buzz aldri nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Red Wine Aging Drug Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 120

Could a pill that's designed to treat Type 2 Diabetes also be the first anti-aging drug? As this ScienCentral News video explains, the pills are based on a substance in, of all things, red wine.

]]> aginganti-agingdiabetesresveratrolsirtrissupplement http://revver.com/video/1097070/red-wine-aging-drug/ http://revver.com/watch/1097070 Red Wine Aging Drug Could a pill that's designed to treat Type 2 Diabetes also be the first anti-aging drug? As this ScienCentral News video explains, the pills are based on a substance in, of all things, red wine. Could a pill that's designed to treat Type 2 Diabetes also be the first anti-aging drug? As this ScienCentral News video explains, the pills are based on a substance in, of all things, red wine. ScienCentral ScienCentral aging anti-aging diabetes resveratrol sirtris supplement nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Curly Hair Gene Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 109

Curly or straight? Too much or too little? If you don't like the hair you were born with, this ScienCentral News video reports that a scientific solution might be in the near future.

]]> curlscurlygenehairproteinsalonstylistwooly http://revver.com/video/1097073/curly-hair-gene/ http://revver.com/watch/1097073 Curly Hair Gene Curly or straight? Too much or too little? If you don't like the hair you were born with, this ScienCentral News video reports that a scientific solution might be in the near future. Curly or straight? Too much or too little? If you don't like the hair you were born with, this ScienCentral News video reports that a scientific solution might be in the near future. ScienCentral ScienCentral curls curly gene hair protein salon stylist wooly nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Emergency Stroke Drug Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 119

Millions of Americans are living with the aftermath of having a stroke. A former Miss Arizona talks about her stroke at age 26, and this ScienCentral News video explains how researchers are looking for safer ways to treat strokes when they happen.

]]> busterclotemergencystroke http://revver.com/video/1097074/emergency-stroke-drug/ http://revver.com/watch/1097074 Emergency Stroke Drug Millions of Americans are living with the aftermath of having a stroke. A former Miss Arizona talks about her stroke at age 26, and this ScienCentral News video explains how researchers are looking for safer ways to treat strokes when they happen. Millions of Americans are living with the aftermath of having a stroke. A former Miss Arizona talks about her stroke at age 26, and this ScienCentral News video explains how researchers are looking for safer ways to treat strokes when they happen. ScienCentral ScienCentral buster clot emergency stroke nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ "The Happening" and Plant Science Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 136

In "The Happening," common plants release a neurotoxin that threatens the survival of the human race. This movie premise may be far-fetched, but scientists say summer is a good time to familiarize yourself with toxic plants that can be harmful to your health. This ScienCentral News video has more.

]]> apocalypsebotanyenvironmentflowersgardeninghappeningherbsmmarkmysteryneurotoxinnightplantssci-fishyamalanthewahlberg http://revver.com/video/1097075/the-happening-and-plant-science/ http://revver.com/watch/1097075 "The Happening" and Plant Science In "The Happening," common plants release a neurotoxin that threatens the survival of the human race. This movie premise may be far-fetched, but scientists say summer is a good time to familiarize yourself with toxic plants that can be harmful to your health. This ScienCentral News video has more. In "The Happening," common plants release a neurotoxin that threatens the survival of the human race. This movie premise may be far-fetched, but scientists say summer is a good time to familiarize yourself with toxic plants that can be harmful to your health. This ScienCentral News video has more. ScienCentral ScienCentral apocalypse botany environment flowers gardening happening herbs m mark mystery neurotoxin night plants sci-fi shyamalan the wahlberg nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Snakes on the Brain Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 105

New research by psychologists suggests we're born ready to look for snakes. As this ScienCentral News video reports, a series of experiments showed that people, even toddlers tend to recognize and locate a snake faster than other plants and animals.

]]> brainevolutionfearophidiophobiaphobiapsychologysnakes http://revver.com/video/1097076/snakes-on-the-brain/ http://revver.com/watch/1097076 Snakes on the Brain New research by psychologists suggests we're born ready to look for snakes. As this ScienCentral News video reports, a series of experiments showed that people, even toddlers tend to recognize and locate a snake faster than other plants and animals. New research by psychologists suggests we're born ready to look for snakes. As this ScienCentral News video reports, a series of experiments showed that people, even toddlers tend to recognize and locate a snake faster than other plants and animals. ScienCentral ScienCentral brain evolution fear ophidiophobia phobia psychology snakes nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Blind Dog Cure Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 118

A dying and blind dog was given a last opportunity to see, thanks to a veterinarian who has figured out why some dogs suddenly go blind. This ScienCentral News video explains.

]]> antibodiesautoimmuneblindblindnessdogeyegoldenretrieverroxivision http://revver.com/video/1097077/blind-dog-cure/ http://revver.com/watch/1097077 Blind Dog Cure A dying and blind dog was given a last opportunity to see, thanks to a veterinarian who has figured out why some dogs suddenly go blind. This ScienCentral News video explains. A dying and blind dog was given a last opportunity to see, thanks to a veterinarian who has figured out why some dogs suddenly go blind. This ScienCentral News video explains. ScienCentral ScienCentral antibodies autoimmune blind blindness dog eye golden retriever roxi vision nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Moms Who Listen Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 106

This Mothers' Day, thank your mom for listening. That's because psychologists now say that explaining things to your mom actually helps you learn better.

]]> educationlearningmotherpatternpreschoolpsychology http://revver.com/video/1097078/moms-who-listen/ http://revver.com/watch/1097078 Moms Who Listen This Mothers' Day, thank your mom for listening. That's because psychologists now say that explaining things to your mom actually helps you learn better. This Mothers' Day, thank your mom for listening. That's because psychologists now say that explaining things to your mom actually helps you learn better. ScienCentral ScienCentral education learning mother pattern preschool psychology nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bad Belly Fat Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 108

Scientists are finding more about how that bulge around your belly is more harmful than the pounds you may have elsewhere on your body. As this ScienCentral News video reports, belly fat may cause blockages in the arteries, and the finding could lead to better drugs to protect against heart disease.

]]> apple-shapearteriescholesteroldiabetesdrugsfatinflammationobesity http://revver.com/video/1097079/bad-belly-fat/ http://revver.com/watch/1097079 Bad Belly Fat Scientists are finding more about how that bulge around your belly is more harmful than the pounds you may have elsewhere on your body. As this ScienCentral News video reports, belly fat may cause blockages in the arteries, and the finding could lead to better drugs to protect against heart disease. Scientists are finding more about how that bulge around your belly is more harmful than the pounds you may have elsewhere on your body. As this ScienCentral News video reports, belly fat may cause blockages in the arteries, and the finding could lead to better drugs to protect against heart disease. ScienCentral ScienCentral apple-shape arteries cholesterol diabetes drugs fat inflammation obesity nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ CO2 For Allergies Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 110

Allergy season is here, and along with your hay fever, you may be experiencing the annoying side effects of today's drugs. But a new treatment for allergies--with fewer side effects--might come from the same substance blamed for global warming, carbon dioxide. This ScienCentral News video explains.

]]> allergiescarbondioxidefeverhayrhinitisseasonsneeze http://revver.com/video/1097080/co2-for-allergies/ http://revver.com/watch/1097080 CO2 For Allergies Allergy season is here, and along with your hay fever, you may be experiencing the annoying side effects of today's drugs. But a new treatment for allergies--with fewer side effects--might come from the same substance blamed for global warming, carbon dioxide. This ScienCentral News video explains. Allergy season is here, and along with your hay fever, you may be experiencing the annoying side effects of today's drugs. But a new treatment for allergies--with fewer side effects--might come from the same substance blamed for global warming, carbon dioxide. This ScienCentral News video explains. ScienCentral ScienCentral allergies carbon dioxide fever hay rhinitis season sneeze nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Brain Size and Alzheimer's Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 106

BrResearchers now say that having a big brain may protect you from the memory-stealing symptoms of Alzheimer's Disease, even if you have the brain plaques associated with the disease.

]]> alzheimersbraindiseasehippocampusmemoryplaquessizetangles http://revver.com/video/1097081/brain-size-and-alzheimers/ http://revver.com/watch/1097081 Brain Size and Alzheimer's BrResearchers now say that having a big brain may protect you from the memory-stealing symptoms of Alzheimer's Disease, even if you have the brain plaques associated with the disease. BrResearchers now say that having a big brain may protect you from the memory-stealing symptoms of Alzheimer's Disease, even if you have the brain plaques associated with the disease. ScienCentral ScienCentral alzheimers brain disease hippocampus memory plaques size tangles nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mars Rover Anniversary Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 106

It's the fourth anniversary of NASA's rover mission to Mars and both "Spirit" and "Opportunity" have made it to spots where their solar panels are getting enough power from the planets' weak winter sunlight. As this ScienCentral News explains, the anniversary marks another incredible milestone, because the rovers were expected to last only a few months.

]]> marsnasaopportunityroverspiritsquyres http://revver.com/video/1097083/mars-rover-anniversary/ http://revver.com/watch/1097083 Mars Rover Anniversary It's the fourth anniversary of NASA's rover mission to Mars and both "Spirit" and "Opportunity" have made it to spots where their solar panels are getting enough power from the planets' weak winter sunlight. As this ScienCentral News explains, the anniversary marks another incredible milestone, because the rovers were expected to last only a few months. It's the fourth anniversary of NASA's rover mission to Mars and both "Spirit" and "Opportunity" have made it to spots where their solar panels are getting enough power from the planets' weak winter sunlight. As this ScienCentral News explains, the anniversary marks another incredible milestone, because the rovers were expected to last only a few months. ScienCentral ScienCentral mars nasa opportunity rover spirit squyres nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Tip of the Tongue Learning Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 104

When you can't quite remember a tricky word or somebody's name, trying to excavate it from your memory might be the worst thing you can do, according to new psychology research. This ScienCentral News video explains.

]]> agingbrainfindinglearningmcmastermemorypsychologyrecalltongueword http://revver.com/video/1097084/tip-of-the-tongue-learning/ http://revver.com/watch/1097084 Tip of the Tongue Learning When you can't quite remember a tricky word or somebody's name, trying to excavate it from your memory might be the worst thing you can do, according to new psychology research. This ScienCentral News video explains. When you can't quite remember a tricky word or somebody's name, trying to excavate it from your memory might be the worst thing you can do, according to new psychology research. This ScienCentral News video explains. ScienCentral ScienCentral aging brain finding learning mcmaster memory psychology recall tongue word nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Fly Flight Simulators Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 109

They don't call them flies for nothing. While we try to avoid the relentless aerial acrobatics of flies, some scientists have built them their own flight simulator. As this ScienCentral News video reports, the work could lead to new flying robots.

]]> behaviorflightflyinsectledmicrobotnanorobotneuroethologypanoramarobot http://revver.com/video/1097085/fly-flight-simulators/ http://revver.com/watch/1097085 Fly Flight Simulators They don't call them flies for nothing. While we try to avoid the relentless aerial acrobatics of flies, some scientists have built them their own flight simulator. As this ScienCentral News video reports, the work could lead to new flying robots. They don't call them flies for nothing. While we try to avoid the relentless aerial acrobatics of flies, some scientists have built them their own flight simulator. As this ScienCentral News video reports, the work could lead to new flying robots. ScienCentral ScienCentral behavior flight fly insect led microbot nanorobot neuroethology panorama robot nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ The Real WALL-E Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 125

The new Disney movie WALL-E features robots of the future actively helping humans. But the future is now. This ScienCentral News video reports on a real robot that could help us take care of elderly relatives from miles away.

]]> asimoassistelderlyhelperrobotroombaubotwall-e http://revver.com/video/1097087/the-real-wall-e/ http://revver.com/watch/1097087 The Real WALL-E The new Disney movie WALL-E features robots of the future actively helping humans. But the future is now. This ScienCentral News video reports on a real robot that could help us take care of elderly relatives from miles away. The new Disney movie WALL-E features robots of the future actively helping humans. But the future is now. This ScienCentral News video reports on a real robot that could help us take care of elderly relatives from miles away. ScienCentral ScienCentral asimo assist elderly helper robot roomba ubot wall-e nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Height and Long Life Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 109

As the infamous Randy Newman song goes, "Short people got no reason to live." Well, researchers now say some short people might actually be living longer, thanks to their genes. This ScienCentral News video explains how a gene that affects people's growth might also help control aging.

]]> ageashkenazigenesgeneticsheightjewishlifelonglongevityold http://revver.com/video/1097088/height-and-long-life/ http://revver.com/watch/1097088 Height and Long Life As the infamous Randy Newman song goes, "Short people got no reason to live." Well, researchers now say some short people might actually be living longer, thanks to their genes. This ScienCentral News video explains how a gene that affects people's growth might also help control aging. As the infamous Randy Newman song goes, "Short people got no reason to live." Well, researchers now say some short people might actually be living longer, thanks to their genes. This ScienCentral News video explains how a gene that affects people's growth might also help control aging. ScienCentral ScienCentral age ashkenazi genes genetics height jewish life long longevity old nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Heart Medicine Gene Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 139

Genetics researchers have debunked a racial myth about who might benefit from a widely used heart failure medication. As this ScienCentral video reports, the finding will eventually allow personalized treatments for this devastating disease.

]]> africanamericanbeta-blockerblackdiseasegeneticheartpersonalizedrace http://revver.com/video/1097090/heart-medicine-gene/ http://revver.com/watch/1097090 Heart Medicine Gene Genetics researchers have debunked a racial myth about who might benefit from a widely used heart failure medication. As this ScienCentral video reports, the finding will eventually allow personalized treatments for this devastating disease. Genetics researchers have debunked a racial myth about who might benefit from a widely used heart failure medication. As this ScienCentral video reports, the finding will eventually allow personalized treatments for this devastating disease. ScienCentral ScienCentral african american beta-blocker black disease genetic heart personalized race nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Cancer Control Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 111

Scientists have discovered molecules that can determine whether cancer tumors will spread to other parts of the body. As this ScienCentral News video explains, the tiny molecules prevent tumors from spreading.

]]> breastcancermicrornapreventionrnatavazoietumor http://revver.com/video/1097092/cancer-control/ http://revver.com/watch/1097092 Cancer Control Scientists have discovered molecules that can determine whether cancer tumors will spread to other parts of the body. As this ScienCentral News video explains, the tiny molecules prevent tumors from spreading. Scientists have discovered molecules that can determine whether cancer tumors will spread to other parts of the body. As this ScienCentral News video explains, the tiny molecules prevent tumors from spreading. ScienCentral ScienCentral breast cancer microrna prevention rna tavazoie tumor nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Asthma Vest Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 113

Scientists are trying out a new tool to determine what triggers asthma attacks, especially in children. As this ScienCentral report explains, engineers have created a vest full of air sampling equipment that monitors and records what's in the air.

]]> asthmaattackchemicalschildrenexposuresensor http://revver.com/video/1097093/asthma-vest/ http://revver.com/watch/1097093 Asthma Vest Scientists are trying out a new tool to determine what triggers asthma attacks, especially in children. As this ScienCentral report explains, engineers have created a vest full of air sampling equipment that monitors and records what's in the air. Scientists are trying out a new tool to determine what triggers asthma attacks, especially in children. As this ScienCentral report explains, engineers have created a vest full of air sampling equipment that monitors and records what's in the air. ScienCentral ScienCentral asthma attack chemicals children exposure sensor nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ "Jumper" and Real Teleportation Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 132

From "Star Trek" to the new sci-fi film "Jumper," we're all familiar with the idea of teleportation. But as this ScienCentral News video explains, scientists are actually doing real teleportation experiments in the lab.

]]> christensencomputinghaydenjumperquantumtelecloningteleportation http://revver.com/video/1097094/jumper-and-real-teleportation/ http://revver.com/watch/1097094 "Jumper" and Real Teleportation From "Star Trek" to the new sci-fi film "Jumper," we're all familiar with the idea of teleportation. But as this ScienCentral News video explains, scientists are actually doing real teleportation experiments in the lab. From "Star Trek" to the new sci-fi film "Jumper," we're all familiar with the idea of teleportation. But as this ScienCentral News video explains, scientists are actually doing real teleportation experiments in the lab. ScienCentral ScienCentral christensen computing hayden jumper quantum telecloning teleportation nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Disarming AIDS Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 123

Scientists have discovered a weakness in the AIDS virus that could lead to a new class of treatments. As this ScienCentral News video explains, the virus acts like a hijacker, turning the body's own machinery against it. But the new research could deprive AIDS of those weapons.

]]> aidselledgegeneticshivproteinssteve http://revver.com/video/1097095/disarming-aids/ http://revver.com/watch/1097095 Disarming AIDS Scientists have discovered a weakness in the AIDS virus that could lead to a new class of treatments. As this ScienCentral News video explains, the virus acts like a hijacker, turning the body's own machinery against it. But the new research could deprive AIDS of those weapons. Scientists have discovered a weakness in the AIDS virus that could lead to a new class of treatments. As this ScienCentral News video explains, the virus acts like a hijacker, turning the body's own machinery against it. But the new research could deprive AIDS of those weapons. ScienCentral ScienCentral aids elledge genetics hiv proteins steve nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mind Reading Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 111

As pollsters have so well demonstrated this presidential primary season, reading minds, whether of voters or the person next to you, is close to impossible. However as this ScienCentral News video explains, scientists are actually one step closer to reading our thoughts.

]]> brainespmindreadingmrineuroscience http://revver.com/video/1097096/mind-reading/ http://revver.com/watch/1097096 Mind Reading As pollsters have so well demonstrated this presidential primary season, reading minds, whether of voters or the person next to you, is close to impossible. However as this ScienCentral News video explains, scientists are actually one step closer to reading our thoughts. As pollsters have so well demonstrated this presidential primary season, reading minds, whether of voters or the person next to you, is close to impossible. However as this ScienCentral News video explains, scientists are actually one step closer to reading our thoughts. ScienCentral ScienCentral brain esp mindreading mri neuroscience nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Supergreenhouse Climate Mystery Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 109

As global temperatures rise, glaciers melt and sea levels go up, right? Well, new research on prehistoric climates indicates that the opposite could somehow be true. As this ScienCentral News video reports, the findings add a new twist to how we think about climate change.

]]> climatefallicelevelsquestionriseseawarming http://revver.com/video/1097097/supergreenhouse-climate-mystery/ http://revver.com/watch/1097097 Supergreenhouse Climate Mystery As global temperatures rise, glaciers melt and sea levels go up, right? Well, new research on prehistoric climates indicates that the opposite could somehow be true. As this ScienCentral News video reports, the findings add a new twist to how we think about climate change. As global temperatures rise, glaciers melt and sea levels go up, right? Well, new research on prehistoric climates indicates that the opposite could somehow be true. As this ScienCentral News video reports, the findings add a new twist to how we think about climate change. ScienCentral ScienCentral climate fall ice levels question rise sea warming nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Lead and Alzheimer's Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 114

We've all heard about the hidden danger lead poses to our children, but what about those of us who were exposed to lead long ago? New research is showing lead exposure might lead to problems much later in life. This ScienCentral News video reports on early evidence of a link between lead and Alzheimer's Disease.

]]> alzheimeralzheimersbrainleadplaquepoisontoxic http://revver.com/video/1097098/lead-and-alzheimers/ http://revver.com/watch/1097098 Lead and Alzheimer's We've all heard about the hidden danger lead poses to our children, but what about those of us who were exposed to lead long ago? New research is showing lead exposure might lead to problems much later in life. This ScienCentral News video reports on early evidence of a link between lead and Alzheimer's Disease. We've all heard about the hidden danger lead poses to our children, but what about those of us who were exposed to lead long ago? New research is showing lead exposure might lead to problems much later in life. This ScienCentral News video reports on early evidence of a link between lead and Alzheimer's Disease. ScienCentral ScienCentral alzheimer alzheimers brain lead plaque poison toxic nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Scared Slow Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 106

After a car accident or other scary experience many people report feeling like the event happened in slow motion. One neuroscientist set out to test whether our brains really see things slowed down in response to fear. This ScienCentral News story shows why he had to scare people in order to do the experiment.

]]> accidentamygdalaperceptionscaredslowtime http://revver.com/video/1097100/scared-slow/ http://revver.com/watch/1097100 Scared Slow After a car accident or other scary experience many people report feeling like the event happened in slow motion. One neuroscientist set out to test whether our brains really see things slowed down in response to fear. This ScienCentral News story shows why he had to scare people in order to do the experiment. After a car accident or other scary experience many people report feeling like the event happened in slow motion. One neuroscientist set out to test whether our brains really see things slowed down in response to fear. This ScienCentral News story shows why he had to scare people in order to do the experiment. ScienCentral ScienCentral accident amygdala perception scared slow time nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Nano Hazards? Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 159

Tiny particles of silver designed to kill germs are being put into socks to control odor. But as this ScienCentral News video explains, what happens to that nanosilver later is concerning some scientists.

]]> bacteriaepagerminfectionmicrobicidenanoparticlespollutionsilver http://revver.com/video/1097101/nano-hazards/ http://revver.com/watch/1097101 Nano Hazards? Tiny particles of silver designed to kill germs are being put into socks to control odor. But as this ScienCentral News video explains, what happens to that nanosilver later is concerning some scientists. Tiny particles of silver designed to kill germs are being put into socks to control odor. But as this ScienCentral News video explains, what happens to that nanosilver later is concerning some scientists. ScienCentral ScienCentral bacteria epa germ infection microbicide nano particles pollution silver nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Cancer Chip Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 101

Researchers have found a new way to identify loose cancer cells in patients' blood. As this ScienCentral News video explains, use of a high tech chip could give doctors a quicker and less invasive way to tell if treatments are working.

]]> biopsycancerchipdetectionearlymicrofluidicsnanonanotechnologytumor http://revver.com/video/1097104/cancer-chip/ http://revver.com/watch/1097104 Cancer Chip Researchers have found a new way to identify loose cancer cells in patients' blood. As this ScienCentral News video explains, use of a high tech chip could give doctors a quicker and less invasive way to tell if treatments are working. Researchers have found a new way to identify loose cancer cells in patients' blood. As this ScienCentral News video explains, use of a high tech chip could give doctors a quicker and less invasive way to tell if treatments are working. ScienCentral ScienCentral biopsy cancer chip detection early microfluidics nano nanotechnology tumor nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Anti-Cancer Blood Transfusion Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 102

Researchers have announced today that they'll soon start human trials of a cancer fighting method that uses blood from people who may be naturally cancer resistant. As this ScienCentral News video explains, for a decade the researchers have studied how this works in mice, and now they've received federal approval to try it in people.

]]> bloodcancerhealthmedicinesciencetransfusiontumorsvideo http://revver.com/video/1097105/anti-cancer-blood-transfusion/ http://revver.com/watch/1097105 Anti-Cancer Blood Transfusion Researchers have announced today that they'll soon start human trials of a cancer fighting method that uses blood from people who may be naturally cancer resistant. As this ScienCentral News video explains, for a decade the researchers have studied how this works in mice, and now they've received federal approval to try it in people. Researchers have announced today that they'll soon start human trials of a cancer fighting method that uses blood from people who may be naturally cancer resistant. As this ScienCentral News video explains, for a decade the researchers have studied how this works in mice, and now they've received federal approval to try it in people. ScienCentral ScienCentral blood cancer health medicine science transfusion tumors video nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Melting Glaciers Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 114

It's "chilling" detective work as scientists try to figure out the mystery of exactly how global warming is causing Greenland's glaciers to speed up on their way to the sea. As this ScienCentral News report explains, however, the leading suspect in this case has been cleared...mostly.

]]> climateenvironmentglacierglobalgreenlandicelakemeltingoceanwarming http://revver.com/video/1097106/melting-glaciers/ http://revver.com/watch/1097106 Melting Glaciers It's "chilling" detective work as scientists try to figure out the mystery of exactly how global warming is causing Greenland's glaciers to speed up on their way to the sea. As this ScienCentral News report explains, however, the leading suspect in this case has been cleared...mostly. It's "chilling" detective work as scientists try to figure out the mystery of exactly how global warming is causing Greenland's glaciers to speed up on their way to the sea. As this ScienCentral News report explains, however, the leading suspect in this case has been cleared...mostly. ScienCentral ScienCentral climate environment glacier global greenland ice lake melting ocean warming nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Immunity Boost Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 102

Amid the news of a $23-million court settlement by the makers of Airborne (a supplement that's earned hundreds of millions of dollars in sales with the claim that it boosts the immune system) biomedical engineers are publishing research on a powder that could turn out to be the real thing. As this ScienCentral News video explains, the new powder could first be used to help fight cancer.

]]> adoptiveaidscancerfluimmuneimmunotherapymedicinesystemt-cells http://revver.com/video/1097107/immunity-boost/ http://revver.com/watch/1097107 Immunity Boost Amid the news of a $23-million court settlement by the makers of Airborne (a supplement that's earned hundreds of millions of dollars in sales with the claim that it boosts the immune system) biomedical engineers are publishing research on a powder that could turn out to be the real thing. As this ScienCentral News video explains, the new powder could first be used to help fight cancer. Amid the news of a $23-million court settlement by the makers of Airborne (a supplement that's earned hundreds of millions of dollars in sales with the claim that it boosts the immune system) biomedical engineers are publishing research on a powder that could turn out to be the real thing. As this ScienCentral News video explains, the new powder could first be used to help fight cancer. ScienCentral ScienCentral adoptive aids cancer flu immune immunotherapy medicine system t-cells nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Magnetic Brain Boost Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 107

Whether it's hitting the books for exams or extreme situations like combat, lack of sleep often comes at times when we need to perform at our best. Now, as this ScienCentral News video reports, brain researchers studying how sleep deprivation impairs memory have found a potential remedy.

]]> braindementiadeprivationexhaustionmagneticmemorysleepstimluationtmstranscranial http://revver.com/video/1097109/magnetic-brain-boost/ http://revver.com/watch/1097109 Magnetic Brain Boost Whether it's hitting the books for exams or extreme situations like combat, lack of sleep often comes at times when we need to perform at our best. Now, as this ScienCentral News video reports, brain researchers studying how sleep deprivation impairs memory have found a potential remedy. Whether it's hitting the books for exams or extreme situations like combat, lack of sleep often comes at times when we need to perform at our best. Now, as this ScienCentral News video reports, brain researchers studying how sleep deprivation impairs memory have found a potential remedy. ScienCentral ScienCentral brain dementia deprivation exhaustion magnetic memory sleep stimluation tms transcranial nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ 3-D Microscope Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 110

Biologists can now observe the workings inside our cells in full color, 3-D and soon to be real-time. As this ScienCentral News video explains, scientists have invented a way to trick a light microscope into revealing more details than ever before seen.

]]> biologycellelectronlightmicroscopenucleuswavelength http://revver.com/video/1097110/3-d-microscope/ http://revver.com/watch/1097110 3-D Microscope Biologists can now observe the workings inside our cells in full color, 3-D and soon to be real-time. As this ScienCentral News video explains, scientists have invented a way to trick a light microscope into revealing more details than ever before seen. Biologists can now observe the workings inside our cells in full color, 3-D and soon to be real-time. As this ScienCentral News video explains, scientists have invented a way to trick a light microscope into revealing more details than ever before seen. ScienCentral ScienCentral biology cell electron light microscope nucleus wavelength nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Jet Stream Shifting Wed, 13 Aug 2008 06:54:26 -0800

Author: ScienCentral
Added: Wed, 13 Aug 2008 06:54:26 -0800
Duration: 110

One of the main drivers of world's weather is moving due to climate change. As this ScienCentral News report explains, scientists are finding that the jet stream, that river of air that pushes storms across the country, is moving towards the north and south poles.

]]> atmospherechangeclimatecurrentglobaljetlightningoceanstormstreamwarmingweatherwind http://revver.com/video/1097111/jet-stream-shifting/ http://revver.com/watch/1097111 Jet Stream Shifting One of the main drivers of world's weather is moving due to climate cha