Videos by amerigo Videos by amerigo http://revver.com/u/amerigo/ http://revver.com webmaster@revver.com Handsaw: Virtual Sections throuth Physical Objects Sat, 12 Apr 2008 09:22:31 -0800

Author: amerigo
Added: Sat, 12 Apr 2008 09:22:31 -0800
Duration: 90

This is the companion video to the paper \"Handsaw: Tangible Exploration of Volumetric Data by Direct Cut-Plane Projection\" written with Jason Alonso, Greg Vargas, Neil Chao, and Hiroshi Ishii and presented at CHI 2008 in Florence, Italy on April 7.

]]> architecturechicomputerdesigndigitalhcimediaproductresearchsectionslicetechnologyvirtual http://revver.com/video/811703/handsaw-virtual-sections-throuth-physical-objects/ http://revver.com/watch/811703 Handsaw: Virtual Sections throuth Physical Objects This is the companion video to the paper \"Handsaw: Tangible Exploration of Volumetric Data by Direct Cut-Plane Projection\" written with Jason Alonso, Greg Vargas, Neil Chao, and Hiroshi Ishii and presented at CHI 2008 in Florence, Italy on April 7. This is the companion video to the paper \"Handsaw: Tangible Exploration of Volumetric Data by Direct Cut-Plane Projection\" written with Jason Alonso, Greg Vargas, Neil Chao, and Hiroshi Ishii and presented at CHI 2008 in Florence, Italy on April 7. amerigo amerigo architecture chi computer design digital hci media product research section slice technology virtual nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Polite Umbrella by JooYoun Paek at Seamless Fashion Show Thu, 31 Jan 2008 14:16:20 -0800

Author: amerigo
Added: Thu, 31 Jan 2008 14:16:20 -0800
Duration: 10

Polite Umbrellas can be shrunk by pulling a cord inside the handle - from the Seamless electronic fashion show at the Boston Museum of Science January 30 2008

]]> designelectronicetiquettefabricfashionflexiblekineticpolitetechtechnologytransformativeumbrellawearable http://revver.com/video/648896/polite-umbrella-by-jooyoun-paek-at-seamless-fashion-show/ http://revver.com/watch/648896 Polite Umbrella by JooYoun Paek at Seamless Fashion Show Polite Umbrellas can be shrunk by pulling a cord inside the handle - from the Seamless electronic fashion show at the Boston Museum of Science January 30 2008 Polite Umbrellas can be shrunk by pulling a cord inside the handle - from the Seamless electronic fashion show at the Boston Museum of Science January 30 2008 amerigo amerigo design electronic etiquette fabric fashion flexible kinetic polite tech technology transformative umbrella wearable nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Rolly Dancing Bluetooth Speakers by Sony Sun, 27 Jan 2008 08:58:52 -0800

Author: amerigo
Added: Sun, 27 Jan 2008 08:58:52 -0800
Duration: 57

This little robot plays music through its tiny speakers while dancing around to the rhythm - I filmed this at the Sony showroom in Ginza (Tokyo).

]]> audiobluetoothcomputerdancinggadgetmp3musicrobotrollspeakerspeakerstechnologywheelwireless http://revver.com/video/639759/rolly-dancing-bluetooth-speakers-by-sony/ http://revver.com/watch/639759 Rolly Dancing Bluetooth Speakers by Sony This little robot plays music through its tiny speakers while dancing around to the rhythm - I filmed this at the Sony showroom in Ginza (Tokyo). This little robot plays music through its tiny speakers while dancing around to the rhythm - I filmed this at the Sony showroom in Ginza (Tokyo). amerigo amerigo audio bluetooth computer dancing gadget mp3 music robot roll speaker speakers technology wheel wireless nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Solar, Wind-Powered 'Seagull' Streetlight by Panasonic Sat, 26 Jan 2008 00:55:42 -0800

Author: amerigo
Added: Sat, 26 Jan 2008 00:55:42 -0800
Duration: 52

This is one of the solar and wind-powered streetlights at the panasonic center in tokyo. a battery in the base stores power generated during the day, and a high-efficiency bulb illuminates the area during the night.

]]> designecologicalenvironmentfurnituregeneratorgreenlightpowerpublicsolarstreetsustainablewindmill http://revver.com/video/638252/solar-wind-powered-seagull-streetlight-by-panasonic/ http://revver.com/watch/638252 Solar, Wind-Powered 'Seagull' Streetlight by Panasonic This is one of the solar and wind-powered streetlights at the panasonic center in tokyo. a battery in the base stores power generated during the day, and a high-efficiency bulb illuminates the area during the night. This is one of the solar and wind-powered streetlights at the panasonic center in tokyo. a battery in the base stores power generated during the day, and a high-efficiency bulb illuminates the area during the night. amerigo amerigo design ecological environment furniture generator green light power public solar street sustainable windmill nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ fly paper Tue, 22 Jan 2008 07:31:21 -0800

Author: amerigo
Added: Tue, 22 Jan 2008 07:31:21 -0800
Duration: 9

this is a flipbook animation i made at a ramen restaurant in tokyo yesterday

]]> animationbirdbookflapflyflyingleafpagepaperwing http://revver.com/video/630639/fly-paper/ http://revver.com/watch/630639 fly paper this is a flipbook animation i made at a ramen restaurant in tokyo yesterday this is a flipbook animation i made at a ramen restaurant in tokyo yesterday amerigo amerigo animation bird book flap fly flying leaf page paper wing nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ political prosthetic by tsitsi gora and ryan murphy Thu, 10 Jan 2008 10:00:22 -0800

Author: amerigo
Added: Thu, 10 Jan 2008 10:00:22 -0800
Duration: 33

In researching the Chinese finger trap, Tsitsi and I noticed that it had many names including Chinese handcuffs and Mexican handcuffs. We thought that by scaling up this gag gift we could turn the derogatory meanings on their head. The handcuff is a simple weaving of semi-rigid strips into a cylinder. When the cylinder is pulled, it is lengthened and thus the circumference shrinks and grabs your finger. Instead of trapping two fingers of one individual, we want to prolong an interaction between two people (handshake). The handshake's purpose is to convey trust, balance, and equality. BUT, there are various peculiarities of the handshake. One common question regarding the greeting is, how long should the handshake last. The handshake cuff is the third party accepting all blame for the extended hand shake. The two participants must work together to end the greeting and if it does go a little long, it was the device's fault not either participants.

]]> fashion design handcuff handsh http://revver.com/video/609956/political-prosthetic-by-tsitsi-gora-and-ryan-murphy/ http://revver.com/watch/609956 political prosthetic by tsitsi gora and ryan murphy In researching the Chinese finger trap, Tsitsi and I noticed that it had many names including Chinese handcuffs and Mexican handcuffs. We thought that by scaling up this gag gift we could turn the derogatory meanings on their head. The handcuff is a simple weaving of semi-rigid strips into a cylinder. When the cylinder is pulled, it is lengthened and thus the circumference shrinks and grabs your finger. Instead of trapping two fingers of one individual, we want to prolong an interaction between two people (handshake). The handshake's purpose is to convey trust, balance, and equality. BUT, there are various peculiarities of the handshake. One common question regarding the greeting is, how long should the handshake last. The handshake cuff is the third party accepting all blame for the extended hand shake. The two participants must work together to end the greeting and if it does go a little long, it was the device's fault not either participants. In researching the Chinese finger trap, Tsitsi and I noticed that it had many names including Chinese handcuffs and Mexican handcuffs. We thought that by scaling up this gag gift we could turn the derogatory meanings on their head. The handcuff is a simple weaving of semi-rigid strips into a cylinder. When the cylinder is pulled, it is lengthened and thus the circumference shrinks and grabs your finger. Instead of trapping two fingers of one individual, we want to prolong an interaction between two people (handshake). The handshake's purpose is to convey trust, balance, and equality. BUT, there are various peculiarities of the handshake. One common question regarding the greeting is, how long should the handshake last. The handshake cuff is the third party accepting all blame for the extended hand shake. The two participants must work together to end the greeting and if it does go a little long, it was the device's fault not either participants. ryan murphy and tsitsi gora, video by leonado bonanni ryan murphy and tsitsi gora, video by leonado bonanni fashion design handcuff handsh nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Minnie the Moocher featuring Betty Boop and Cab Calloway Sat, 05 Jan 2008 10:58:22 -0800

Author: amerigo
Added: Sat, 05 Jan 2008 10:58:22 -0800
Duration: 466

This 1933 classic cartoon features and sights and sounds of Cab Calloway's jazz orchestra incorporated into the animation using Max Fleischer's revolutionary rotoscope technique to capture the dance moves of the bandleader and superimpose them on characters in the fantastic story.

]]> betty boop sexy home sweet lea http://revver.com/video/601494/minnie-the-moocher-featuring-betty-boop-and-cab-calloway/ http://revver.com/watch/601494 Minnie the Moocher featuring Betty Boop and Cab Calloway This 1933 classic cartoon features and sights and sounds of Cab Calloway's jazz orchestra incorporated into the animation using Max Fleischer's revolutionary rotoscope technique to capture the dance moves of the bandleader and superimpose them on characters in the fantastic story. This 1933 classic cartoon features and sights and sounds of Cab Calloway's jazz orchestra incorporated into the animation using Max Fleischer's revolutionary rotoscope technique to capture the dance moves of the bandleader and superimpose them on characters in the fantastic story. fleischer studios fleischer studios betty boop sexy home sweet lea nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Snow White featuring Betty Boop and Cab Calloway Fri, 04 Jan 2008 15:48:17 -0800

Author: amerigo
Added: Fri, 04 Jan 2008 15:48:17 -0800
Duration: 424

This 1933 rendition of the classic fairy tale incorporates Cab Calloway's dancing through the use of rotoscope motion capture and his orchestra's performance in a beautifully animated cartoon.

]]> animation rotoscope betty boop http://revver.com/video/599754/snow-white-featuring-betty-boop-and-cab-calloway/ http://revver.com/watch/599754 Snow White featuring Betty Boop and Cab Calloway This 1933 rendition of the classic fairy tale incorporates Cab Calloway's dancing through the use of rotoscope motion capture and his orchestra's performance in a beautifully animated cartoon. This 1933 rendition of the classic fairy tale incorporates Cab Calloway's dancing through the use of rotoscope motion capture and his orchestra's performance in a beautifully animated cartoon. Fleischer Studios Fleischer Studios animation rotoscope betty boop nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ The Old Man of the Mountain featuring Cab Calloway and Betty Boop Fri, 04 Jan 2008 14:36:25 -0800

Author: amerigo
Added: Fri, 04 Jan 2008 14:36:25 -0800
Duration: 412

This Betty Boop Cartoon from 1932 is the masterpiece of Fleisher Studios, featuring rotoscope animation of Cab Calloway dancing along to his big band sounds. It is available in the public domain at http://www.archive.org/details/bb_old_man_of_the_mountain

]]> cartoon animation betty boop c http://revver.com/video/599726/the-old-man-of-the-mountain-featuring-cab-calloway-and-betty-boop/ http://revver.com/watch/599726 The Old Man of the Mountain featuring Cab Calloway and Betty Boop This Betty Boop Cartoon from 1932 is the masterpiece of Fleisher Studios, featuring rotoscope animation of Cab Calloway dancing along to his big band sounds. It is available in the public domain at http://www.archive.org/details/bb_old_man_of_the_mountain This Betty Boop Cartoon from 1932 is the masterpiece of Fleisher Studios, featuring rotoscope animation of Cab Calloway dancing along to his big band sounds. It is available in the public domain at http://www.archive.org/details/bb_old_man_of_the_mountain Fleischer Studios Fleischer Studios cartoon animation betty boop c nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ I'll be Glad When You're Dead You Rascal You featuring Louis Armstrong and Betty Boop Fri, 04 Jan 2008 10:06:23 -0800

Author: amerigo
Added: Fri, 04 Jan 2008 10:06:23 -0800
Duration: 429

This disturbing 1931 cartoon features Louis Armstrong and his orchestra combined with a Betty Boop cartoon starring Bimbo and Koko.

]]> cartoon animation http://revver.com/video/599171/ill-be-glad-when-youre-dead-you-rascal-you-featuring-louis-armstrong-and-betty-boop/ http://revver.com/watch/599171 I'll be Glad When You're Dead You Rascal You featuring Louis Armstrong and Betty Boop This disturbing 1931 cartoon features Louis Armstrong and his orchestra combined with a Betty Boop cartoon starring Bimbo and Koko. This disturbing 1931 cartoon features Louis Armstrong and his orchestra combined with a Betty Boop cartoon starring Bimbo and Koko. Fleicher Studios Fleicher Studios cartoon animation nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ connection coat by sonia klemperer-johnson Mon, 17 Dec 2007 13:58:06 -0800

Author: amerigo
Added: Mon, 17 Dec 2007 13:58:06 -0800
Duration: 80

this is a line of outdoor clothing that allows close physical contact despite cold weather

]]> fashion affection design http://revver.com/video/532752/connection-coat-by-sonia-klemperer-johnson/ http://revver.com/watch/532752 connection coat by sonia klemperer-johnson this is a line of outdoor clothing that allows close physical contact despite cold weather this is a line of outdoor clothing that allows close physical contact despite cold weather gabriel blue cira, paulina modlitba, leonardo bonanni gabriel blue cira, paulina modlitba, leonardo bonanni fashion affection design nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ UNRAVEL fashion show at SIGGRAPH 2007 Fri, 19 Oct 2007 17:04:06 -0800

Author: amerigo
Added: Fri, 19 Oct 2007 17:04:06 -0800
Duration: 577

this is the complete video of the unravel fashion from from the siggraph 2007 conference in san diego, california

]]> computercyberdesigndigitalfashiongadgetgeekgraphicsseamstresssiggraphtechnologyunravelwearable http://revver.com/video/441720/unravel-fashion-show-at-siggraph-2007/ http://revver.com/watch/441720 UNRAVEL fashion show at SIGGRAPH 2007 this is the complete video of the unravel fashion from from the siggraph 2007 conference in san diego, california this is the complete video of the unravel fashion from from the siggraph 2007 conference in san diego, california leonardo bonanni leonardo bonanni computer cyber design digital fashion gadget geek graphics seamstress siggraph technology unravel wearable nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ fashion on demand / shape memory clothing Mon, 15 Oct 2007 23:37:03 -0800

Author: amerigo
Added: Mon, 15 Oct 2007 23:37:03 -0800
Duration: 83

the <a href="http://leo.media.mit.edu/?p=33">dishmaker</a> showed me that a mini-factory can replace cabinets full of dishes, so i figured that a personal tailor could replace closets full of clothes. you could get fitted for tailor-made clothes in the morning and throw them away when you go to bed at night. ideally the material could be re-used with less energy than washing and ironing clothes. in this movie i use shape memory or shrink plastic cloth that shrivels when exposed to heat. the plastic fibers were stretched before being made into a tube, so they return to their original shape when they are heated. to reset, you can just stretch our your clothes at night and they can be re-fitted the next morning.

]]> barbiecompositedemanddesignerfab-labfabricationfashionmanufacturingmemorypersonalplasticpolymershapeshrinktubewearablewrap http://revver.com/video/435955/fashion-on-demand-shape-memory-clothing/ http://revver.com/watch/435955 fashion on demand / shape memory clothing the <a href="http://leo.media.mit.edu/?p=33">dishmaker</a> showed me that a mini-factory can replace cabinets full of dishes, so i figured that a personal tailor could replace closets full of clothes. you could get fitted for tailor-made clothes in the morning and throw them away when you go to bed at night. ideally the material could be re-used with less energy than washing and ironing clothes. in this movie i use shape memory or shrink plastic cloth that shrivels when exposed to heat. the plastic fibers were stretched before being made into a tube, so they return to their original shape when they are heated. to reset, you can just stretch our your clothes at night and they can be re-fitted the next morning. the <a href="http://leo.media.mit.edu/?p=33">dishmaker</a> showed me that a mini-factory can replace cabinets full of dishes, so i figured that a personal tailor could replace closets full of clothes. you could get fitted for tailor-made clothes in the morning and throw them away when you go to bed at night. ideally the material could be re-used with less energy than washing and ironing clothes. in this movie i use shape memory or shrink plastic cloth that shrivels when exposed to heat. the plastic fibers were stretched before being made into a tube, so they return to their original shape when they are heated. to reset, you can just stretch our your clothes at night and they can be re-fitted the next morning. leonardo bonanni leonardo bonanni barbie composite demand designer fab-lab fabrication fashion manufacturing memory personal plastic polymer shape shrink tube wearable wrap nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ negotiation at the siggraph 2007 unravel fashion show by Daniela Kostova, Galina Kumanova & Olivia Robinson Sun, 16 Sep 2007 11:56:47 -0800

Author: amerigo
Added: Sun, 16 Sep 2007 11:56:47 -0800
Duration: 41

Negotiation is a wearable interactive video system that combines textiles and technology to explore concepts of identity creation, presence and absence, integration and estrangement in different political and cultural environments. During site-specific performances, video from two characters (an Alien and an Authority) are composited and displayed real-time creating a negotiated final video that highlights boundaries. While in Sardinia, Italy, the performance brought attention to the limits of cross-cultural communication between “us” and “others,” the characters and the federal police, the police and “others,” as well as between the two characters. While drawing from theoretical concepts like the “invisible immigrant” and “double consciousness,” the warped video is a metaphor for how one’s image and self-identity is a negotiation between the watcher, the watched, and the environment.

]]> artauthoritybluebluescreencamouflagecloakdominationfashiongadgetgizmodoimmigrantinstallationinvisibilityinvisibleoppressedoppressionpoliticalsiggraphsurveillancetechtechnologywearable http://revver.com/video/399163/negotiation-at-the-siggraph-2007-unravel-fashion-show-by-daniela-kostova-galina-kumanova-olivia-robinson/ http://revver.com/watch/399163 negotiation at the siggraph 2007 unravel fashion show by Daniela Kostova, Galina Kumanova & Olivia Robinson Negotiation is a wearable interactive video system that combines textiles and technology to explore concepts of identity creation, presence and absence, integration and estrangement in different political and cultural environments. During site-specific performances, video from two characters (an Alien and an Authority) are composited and displayed real-time creating a negotiated final video that highlights boundaries. While in Sardinia, Italy, the performance brought attention to the limits of cross-cultural communication between “us” and “others,” the characters and the federal police, the police and “others,” as well as between the two characters. While drawing from theoretical concepts like the “invisible immigrant” and “double consciousness,” the warped video is a metaphor for how one’s image and self-identity is a negotiation between the watcher, the watched, and the environment. Negotiation is a wearable interactive video system that combines textiles and technology to explore concepts of identity creation, presence and absence, integration and estrangement in different political and cultural environments. During site-specific performances, video from two characters (an Alien and an Authority) are composited and displayed real-time creating a negotiated final video that highlights boundaries. While in Sardinia, Italy, the performance brought attention to the limits of cross-cultural communication between “us” and “others,” the characters and the federal police, the police and “others,” as well as between the two characters. While drawing from theoretical concepts like the “invisible immigrant” and “double consciousness,” the warped video is a metaphor for how one’s image and self-identity is a negotiation between the watcher, the watched, and the environment. Daniela Kostova, Galina Kumanova & Olivia Robinson, Leonardo Bonanni Daniela Kostova, Galina Kumanova & Olivia Robinson, Leonardo Bonanni art authority blue bluescreen camouflage cloak domination fashion gadget gizmodo immigrant installation invisibility invisible oppressed oppression political siggraph surveillance tech technology wearable nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ cory kidd presents 'autom' the robot diet coach at the AARP conference in Boston 2007 Tue, 11 Sep 2007 08:35:33 -0800

Author: amerigo
Added: Tue, 11 Sep 2007 08:35:33 -0800
Duration: 279

'autom' is a robotic weight loss coach that helps its owner track diet and exercise for sustained healthy behavior. from the website "Autom helps by encouraging a person to stick with a diet for long enough to create long-term change and keep extra pounds off."

]]> automataautomateddietexercisefathealthintuitivekineticlossmedialabmitrobotroboticsociablesocialweight http://revver.com/video/393072/cory-kidd-presents-autom-the-robot-diet-coach-at-the-aarp-conference-in-boston-2007/ http://revver.com/watch/393072 cory kidd presents 'autom' the robot diet coach at the AARP conference in Boston 2007 'autom' is a robotic weight loss coach that helps its owner track diet and exercise for sustained healthy behavior. from the website "Autom helps by encouraging a person to stick with a diet for long enough to create long-term change and keep extra pounds off." 'autom' is a robotic weight loss coach that helps its owner track diet and exercise for sustained healthy behavior. from the website "Autom helps by encouraging a person to stick with a diet for long enough to create long-term change and keep extra pounds off." cory kidd, leonardo bonanni cory kidd, leonardo bonanni automata automated diet exercise fat health intuitive kinetic loss medialab mit robot robotic sociable social weight nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ leah buechley presents 'bracelets' at the siggraph 2007 unravel fashion show Fri, 07 Sep 2007 08:05:22 -0800

Author: amerigo
Added: Fri, 07 Sep 2007 08:05:22 -0800
Duration: 50

Woven bracelets—created on traditional bead looms out of beads, conductive thread and surface mount LEDs—function as motion-sensing, communicating wearable displays. The bracelets are almost as thin and flexible as traditional beaded jewelry, controlled with surface mount electronics and soft conductive materials and powered with flexible Lithium-ion batteries. Each one contains an accelerometer that senses wrist movement and a Bluetooth module for wireless communication. They can communicate with laptops, PDAs and cell phones as well as other bracelets and wearables.

]]> buechleycircuitcomputerdiodeelectronicsengadgetfashiongadgetgizmodojewelryledmedialabsiggraphtechtechnologyunravelwearablewoven http://revver.com/video/389035/leah-buechley-presents-bracelets-at-the-siggraph-2007-unravel-fashion-show/ http://revver.com/watch/389035 leah buechley presents 'bracelets' at the siggraph 2007 unravel fashion show Woven bracelets—created on traditional bead looms out of beads, conductive thread and surface mount LEDs—function as motion-sensing, communicating wearable displays. The bracelets are almost as thin and flexible as traditional beaded jewelry, controlled with surface mount electronics and soft conductive materials and powered with flexible Lithium-ion batteries. Each one contains an accelerometer that senses wrist movement and a Bluetooth module for wireless communication. They can communicate with laptops, PDAs and cell phones as well as other bracelets and wearables. Woven bracelets—created on traditional bead looms out of beads, conductive thread and surface mount LEDs—function as motion-sensing, communicating wearable displays. The bracelets are almost as thin and flexible as traditional beaded jewelry, controlled with surface mount electronics and soft conductive materials and powered with flexible Lithium-ion batteries. Each one contains an accelerometer that senses wrist movement and a Bluetooth module for wireless communication. They can communicate with laptops, PDAs and cell phones as well as other bracelets and wearables. leah buechley, leonardo bonanni leah buechley, leonardo bonanni buechley circuit computer diode electronics engadget fashion gadget gizmodo jewelry led medialab siggraph tech technology unravel wearable woven nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ barbara layne presents jacket antics at the siggraph 2007 unravel fashion show Wed, 05 Sep 2007 12:44:18 -0800

Author: amerigo
Added: Wed, 05 Sep 2007 12:44:18 -0800
Duration: 52

Jacket Antics feature unique texts and designs scrolling through the LED array on each of the backs. Traditional black linen yarns are hand woven alongside light emitting diodes, microcontrollers and sensors. When the wearers hold hands, the LED arrays presents a third, synchronous message that scrolls from one to the other, presenting a new pattern of communication. When the wearers release hands, the message reverts back to the individual themes. The capacity for interactivity in the animated cloth displays extend the narrative qualities of cloth and provide new possibilities for dynamic social interaction.

]]> circuitsclothingcomputercyborgdisplayelectronicsengadgetfashionfuturegadgetgizmodoglowingjacketledmarqueerunwaysewsewnshowsiggraphsofttechtechnologyunravelwearableweavewoven http://revver.com/video/386584/barbara-layne-presents-jacket-antics-at-the-siggraph-2007-unravel-fashion-show/ http://revver.com/watch/386584 barbara layne presents jacket antics at the siggraph 2007 unravel fashion show Jacket Antics feature unique texts and designs scrolling through the LED array on each of the backs. Traditional black linen yarns are hand woven alongside light emitting diodes, microcontrollers and sensors. When the wearers hold hands, the LED arrays presents a third, synchronous message that scrolls from one to the other, presenting a new pattern of communication. When the wearers release hands, the message reverts back to the individual themes. The capacity for interactivity in the animated cloth displays extend the narrative qualities of cloth and provide new possibilities for dynamic social interaction. Jacket Antics feature unique texts and designs scrolling through the LED array on each of the backs. Traditional black linen yarns are hand woven alongside light emitting diodes, microcontrollers and sensors. When the wearers hold hands, the LED arrays presents a third, synchronous message that scrolls from one to the other, presenting a new pattern of communication. When the wearers release hands, the message reverts back to the individual themes. The capacity for interactivity in the animated cloth displays extend the narrative qualities of cloth and provide new possibilities for dynamic social interaction. barbara layne, leonardo bonanni barbara layne, leonardo bonanni circuits clothing computer cyborg display electronics engadget fashion future gadget gizmodo glowing jacket led marquee runway sew sewn show siggraph soft tech technology unravel wearable weave woven nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ jenny chowdhury presents intimate controllers at the siggraph 2007 unravel fashion show Fri, 31 Aug 2007 17:55:09 -0800

Author: amerigo
Added: Fri, 31 Aug 2007 17:55:09 -0800
Duration: 45

intimate controllers are sewn into a woman's bra and a man's boxers for a new kind of video game experience. intended for intimate couples, the game is played like dance dance revolution as players touch different parts of each other in time with visual cues. pressure sensors are sewn into the undergarments to record touch. three kinds of sensors are provided for three levels of play.

]]> boxersbracontrollercouplecuddledanceengadgeteroticfashiongadgetgamegizmodointerfacemannintendoplaystationpressurerevolutionsegasensorsexysiggraphsqueezetouchunavelunderwearvideowearablewoman http://revver.com/video/381862/jenny-chowdhury-presents-intimate-controllers-at-the-siggraph-2007-unravel-fashion-show/ http://revver.com/watch/381862 jenny chowdhury presents intimate controllers at the siggraph 2007 unravel fashion show intimate controllers are sewn into a woman's bra and a man's boxers for a new kind of video game experience. intended for intimate couples, the game is played like dance dance revolution as players touch different parts of each other in time with visual cues. pressure sensors are sewn into the undergarments to record touch. three kinds of sensors are provided for three levels of play. intimate controllers are sewn into a woman's bra and a man's boxers for a new kind of video game experience. intended for intimate couples, the game is played like dance dance revolution as players touch different parts of each other in time with visual cues. pressure sensors are sewn into the undergarments to record touch. three kinds of sensors are provided for three levels of play. jenny chowdhury, leonardo bonanni jenny chowdhury, leonardo bonanni boxers bra controller couple cuddle dance engadget erotic fashion gadget game gizmodo interface man nintendo playstation pressure revolution sega sensor sexy siggraph squeeze touch unavel underwear video wearable woman nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ animated crosswalk in granada spain Tue, 28 Aug 2007 14:40:18 -0800

Author: amerigo
Added: Tue, 28 Aug 2007 14:40:18 -0800
Duration: 22

this is how the 'walk' signs look in granada (spain): the ubiquitous green LED matrix is animated into a silly walking figure

]]> animationartcrossingcrosswalkdesigndisplaydontengadgetgadgetgizmodogranadaledpedpedestrianpublicsafetyscreenspainstreetstreetlighttechtechnologywalkxing http://revver.com/video/378289/animated-crosswalk-in-granada-spain/ http://revver.com/watch/378289 animated crosswalk in granada spain this is how the 'walk' signs look in granada (spain): the ubiquitous green LED matrix is animated into a silly walking figure this is how the 'walk' signs look in granada (spain): the ubiquitous green LED matrix is animated into a silly walking figure leonardo bonanni leonardo bonanni animation art crossing crosswalk design display dont engadget gadget gizmodo granada led ped pedestrian public safety screen spain street streetlight tech technology walk xing nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ connor dickie presents kameraflage at the siggraph 2007 unravel fashion show Mon, 27 Aug 2007 22:04:07 -0800

Author: amerigo
Added: Mon, 27 Aug 2007 22:04:07 -0800
Duration: 31

kameraflage is a system that allows you to project luminous images that only digital cameras can see - by connor dickie presented at siggraph 2007 unravel fashion show

]]> camouflageconferenceconnordickieengadgetfashionfuturegadgetgizmodograffitiinfraredinvisiblekameraflageprojectionshowsiggraphsystemtechnologywearable http://revver.com/video/377603/connor-dickie-presents-kameraflage-at-the-siggraph-2007-unravel-fashion-show/ http://revver.com/watch/377603 connor dickie presents kameraflage at the siggraph 2007 unravel fashion show kameraflage is a system that allows you to project luminous images that only digital cameras can see - by connor dickie presented at siggraph 2007 unravel fashion show kameraflage is a system that allows you to project luminous images that only digital cameras can see - by connor dickie presented at siggraph 2007 unravel fashion show connor dickie, leonardo bonanni connor dickie, leonardo bonanni camouflage conference connor dickie engadget fashion future gadget gizmodo graffiti infrared invisible kameraflage projection show siggraph system technology wearable nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ flexible display by eink at siggraph 2007 Fri, 24 Aug 2007 12:55:11 -0800

Author: amerigo
Added: Fri, 24 Aug 2007 12:55:11 -0800
Duration: 34

this is a brief video showing the eink flexible grayscale reflective display at siggraph 2007 in san diego. the display uses electronic ink, consisting of microscopic two-tone spheres that are polarized so that a current can flip them from white to black. when the screen receives no power, it keeps the last image it had displayed for several months. the display works in sunlight since it is reflective, and the new generation of thin-film transistors used to drive the display is thin and flexible enough for the screen to be rolled up around a thin rod.

]]> displayeinkelectronicengadgetflexiblegadgetgizmodograyscaleinkreflectiverollrollablescreensoftspindletechnology http://revver.com/video/373961/flexible-display-by-eink-at-siggraph-2007/ http://revver.com/watch/373961 flexible display by eink at siggraph 2007 this is a brief video showing the eink flexible grayscale reflective display at siggraph 2007 in san diego. the display uses electronic ink, consisting of microscopic two-tone spheres that are polarized so that a current can flip them from white to black. when the screen receives no power, it keeps the last image it had displayed for several months. the display works in sunlight since it is reflective, and the new generation of thin-film transistors used to drive the display is thin and flexible enough for the screen to be rolled up around a thin rod. this is a brief video showing the eink flexible grayscale reflective display at siggraph 2007 in san diego. the display uses electronic ink, consisting of microscopic two-tone spheres that are polarized so that a current can flip them from white to black. when the screen receives no power, it keeps the last image it had displayed for several months. the display works in sunlight since it is reflective, and the new generation of thin-film transistors used to drive the display is thin and flexible enough for the screen to be rolled up around a thin rod. leonardo bonanni, connor dickie leonardo bonanni, connor dickie display eink electronic engadget flexible gadget gizmodo grayscale ink reflective roll rollable screen soft spindle technology nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ the first 10 years of the Yahoo! homepage Wed, 22 Aug 2007 15:28:07 -0800

Author: amerigo
Added: Wed, 22 Aug 2007 15:28:07 -0800
Duration: 67

i made a timelapse of yahoo.com from 1996-2005 from 937 frames at the wayback machine (internetarchive.org)

]]> adsadvertisementcomplexitydesignevolutiongraphichomepageinternetsimplicitytimelapsewebweb20wwwyahoo http://revver.com/video/371685/the-first-10-years-of-the-yahoo-homepage/ http://revver.com/watch/371685 the first 10 years of the Yahoo! homepage i made a timelapse of yahoo.com from 1996-2005 from 937 frames at the wayback machine (internetarchive.org) i made a timelapse of yahoo.com from 1996-2005 from 937 frames at the wayback machine (internetarchive.org) leonardo bonanni leonardo bonanni ads advertisement complexity design evolution graphic homepage internet simplicity timelapse web web20 www yahoo nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ taptap: a wearable device for touch therapy Wed, 22 Aug 2007 10:26:50 -0800

Author: amerigo
Added: Wed, 22 Aug 2007 10:26:50 -0800
Duration: 155

TapTap is a wearable haptic system that allows nurturing human touch to be recorded, broadcast and played back for emotional therapy. Haptic input/output modules in a convenient modular scarf provide affectionate touch that can be personalized. We present a working prototype informed by a pilot study.

]]> clothingeffectorfashionhugmassagemedialabmitplaybackrecordrobotscarfsensorsqueezetechnologytherapytouchwearable http://revver.com/video/371218/taptap-a-wearable-device-for-touch-therapy/ http://revver.com/watch/371218 taptap: a wearable device for touch therapy TapTap is a wearable haptic system that allows nurturing human touch to be recorded, broadcast and played back for emotional therapy. Haptic input/output modules in a convenient modular scarf provide affectionate touch that can be personalized. We present a working prototype informed by a pilot study. TapTap is a wearable haptic system that allows nurturing human touch to be recorded, broadcast and played back for emotional therapy. Haptic input/output modules in a convenient modular scarf provide affectionate touch that can be personalized. We present a working prototype informed by a pilot study. leonardo bonanni, jeff lieberman, cati vaucelle, orit zuckerman leonardo bonanni, jeff lieberman, cati vaucelle, orit zuckerman clothing effector fashion hug massage medialab mit playback record robot scarf sensor squeeze technology therapy touch wearable nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ smartsink: context-aware work surface Wed, 22 Aug 2007 10:26:50 -0800

Author: amerigo
Added: Wed, 22 Aug 2007 10:26:50 -0800
Duration: 121

We have become accustomed to a digital desktop that is customizable and anticipates our needs. What if our physical work surfaces could interact with us in the same way? We have recently completed a working prototype of a work surface that automatically adjusts to individual users and anticipates their needs. The work surface is a large sink and counter suitable for installation in multi-user environments where hygiene and ergonomics are important, such as hospitals and commercial or residential kitchens. Vision-based sensing allows the fixture to adjust to your height automatically, to choose when to dispense water and to adjust the temperature of the water based on your needs. The water and work surfaces act as graphical interfaces to inform the user of the sink’s status. The work surface is made from soft, strong materials that absorb noise and minimize breakage of delicate objects. As a context-aware appliance, SmartSink allows the user to remain concentrated on the task at hand, only offering information in an informative, unobtrusive manner.

]]> appliancecolordevicefuturegadgetheightkitchenmovingprototyperubbersiliconesinksofttechnologywater http://revver.com/video/371220/smartsink-context-aware-work-surface/ http://revver.com/watch/371220 smartsink: context-aware work surface We have become accustomed to a digital desktop that is customizable and anticipates our needs. What if our physical work surfaces could interact with us in the same way? We have recently completed a working prototype of a work surface that automatically adjusts to individual users and anticipates their needs. The work surface is a large sink and counter suitable for installation in multi-user environments where hygiene and ergonomics are important, such as hospitals and commercial or residential kitchens. Vision-based sensing allows the fixture to adjust to your height automatically, to choose when to dispense water and to adjust the temperature of the water based on your needs. The water and work surfaces act as graphical interfaces to inform the user of the sink’s status. The work surface is made from soft, strong materials that absorb noise and minimize breakage of delicate objects. As a context-aware appliance, SmartSink allows the user to remain concentrated on the task at hand, only offering information in an informative, unobtrusive manner. We have become accustomed to a digital desktop that is customizable and anticipates our needs. What if our physical work surfaces could interact with us in the same way? We have recently completed a working prototype of a work surface that automatically adjusts to individual users and anticipates their needs. The work surface is a large sink and counter suitable for installation in multi-user environments where hygiene and ergonomics are important, such as hospitals and commercial or residential kitchens. Vision-based sensing allows the fixture to adjust to your height automatically, to choose when to dispense water and to adjust the temperature of the water based on your needs. The water and work surfaces act as graphical interfaces to inform the user of the sink’s status. The work surface is made from soft, strong materials that absorb noise and minimize breakage of delicate objects. As a context-aware appliance, SmartSink allows the user to remain concentrated on the task at hand, only offering information in an informative, unobtrusive manner. leonardo bonanni, chia-hsun lee, sam sarcia, jon wetzel leonardo bonanni, chia-hsun lee, sam sarcia, jon wetzel appliance color device future gadget height kitchen moving prototype rubber silicone sink soft technology water nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ augmented reality kitchen Wed, 22 Aug 2007 10:26:50 -0800

Author: amerigo
Added: Wed, 22 Aug 2007 10:26:50 -0800
Duration: 151

The glut of information produced by ubiquitous computing in augmented reality environments requires that the resulting information displays be tailored to the attention of users and mapped directly to the objects and surfaces of the space. This paper proposes a method for designing and implementing ambient information displays combining ambient displays and augmented reality to produce useful intuitive interfaces that are concretely mapped to architectural spaces for the purposes of expanding and enriching the quality and sensuality of user experience.

]]> augmentedcoldconservationdryenergyflamesfuturehotkitchenprojectionprojectorrealityrefrigeratorripplestovesynesthesiavirtualwaterwet http://revver.com/video/371227/augmented-reality-kitchen/ http://revver.com/watch/371227 augmented reality kitchen The glut of information produced by ubiquitous computing in augmented reality environments requires that the resulting information displays be tailored to the attention of users and mapped directly to the objects and surfaces of the space. This paper proposes a method for designing and implementing ambient information displays combining ambient displays and augmented reality to produce useful intuitive interfaces that are concretely mapped to architectural spaces for the purposes of expanding and enriching the quality and sensuality of user experience. The glut of information produced by ubiquitous computing in augmented reality environments requires that the resulting information displays be tailored to the attention of users and mapped directly to the objects and surfaces of the space. This paper proposes a method for designing and implementing ambient information displays combining ambient displays and augmented reality to produce useful intuitive interfaces that are concretely mapped to architectural spaces for the purposes of expanding and enriching the quality and sensuality of user experience. leonardo bonanni, chia-hsun lee leonardo bonanni, chia-hsun lee augmented cold conservation dry energy flames future hot kitchen projection projector reality refrigerator ripple stove synesthesia virtual water wet nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ personal mapping Tue, 21 Aug 2007 23:10:11 -0800

Author: amerigo
Added: Tue, 21 Aug 2007 23:10:11 -0800
Duration: 22

this is a hand-drawn voyage through my first 18 years: florence brussels chicago and new york

]]> belgiumbrusselsbruxellescartoonchicagodrawingfirenzeflorenceflyflyingitalynewperspectiveyork http://revver.com/video/370753/personal-mapping/ http://revver.com/watch/370753 personal mapping this is a hand-drawn voyage through my first 18 years: florence brussels chicago and new york this is a hand-drawn voyage through my first 18 years: florence brussels chicago and new york leonardo bonanni leonardo bonanni belgium brussels bruxelles cartoon chicago drawing firenze florence fly flying italy new perspective york nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ ladycoy Tue, 21 Aug 2007 21:04:07 -0800

Author: amerigo
Added: Tue, 21 Aug 2007 21:04:07 -0800
Duration: 440

ladycoy is a papier-mâché woman on the street at night, witness to her surroundings through a small movie camera in her head. more ladycoy is a papier-mâché woman on the street at night, witness to her surroundings through a small movie camera in her head.

]]> artclubconceptualdecoydummyfeminismguerillaharassmentinstallationmannequinnightsousveillancestreetsurveillancevideowoman http://revver.com/video/370267/ladycoy/ http://revver.com/watch/370267 ladycoy ladycoy is a papier-mâché woman on the street at night, witness to her surroundings through a small movie camera in her head. more ladycoy is a papier-mâché woman on the street at night, witness to her surroundings through a small movie camera in her head. ladycoy is a papier-mâché woman on the street at night, witness to her surroundings through a small movie camera in her head. more ladycoy is a papier-mâché woman on the street at night, witness to her surroundings through a small movie camera in her head. leonardo bonanni, vanessa harden leonardo bonanni, vanessa harden art club conceptual decoy dummy feminism guerilla harassment installation mannequin night sousveillance street surveillance video woman adult http://creativecommons.org/licenses/by-nc-nd/2.5/ heatsink Tue, 21 Aug 2007 14:55:10 -0800

Author: amerigo
Added: Tue, 21 Aug 2007 14:55:10 -0800
Duration: 15

this is the world's first color-changing faucet - a prototype i made at the counterintelligence lab in october 2003 with the help of toshiyuki takasaki

]]> color-changingconservationcoolfaucetfutureglowingh2oindicatorinventionkitchenledlightsinktaptemperaturewater http://revver.com/video/370264/heatsink/ http://revver.com/watch/370264 heatsink this is the world's first color-changing faucet - a prototype i made at the counterintelligence lab in october 2003 with the help of toshiyuki takasaki this is the world's first color-changing faucet - a prototype i made at the counterintelligence lab in october 2003 with the help of toshiyuki takasaki leonardo bonanni leonardo bonanni color-changing conservation cool faucet future glowing h2o indicator invention kitchen led light sink tap temperature water nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ playpals Tue, 21 Aug 2007 14:22:11 -0800

Author: amerigo
Added: Tue, 21 Aug 2007 14:22:11 -0800
Duration: 138

these dolls allow children to play remotely and create and share multimedia content. they were invented at the mit media lab by leonardo bonanni, jeff lieberman, cati vaucelle and orit zuckerman

]]> childchildrencommunicationcopresencedollgadgetinterfacekidsmedialabmitremoterobottangibletelepresencetoy http://revver.com/video/370250/playpals/ http://revver.com/watch/370250 playpals these dolls allow children to play remotely and create and share multimedia content. they were invented at the mit media lab by leonardo bonanni, jeff lieberman, cati vaucelle and orit zuckerman these dolls allow children to play remotely and create and share multimedia content. they were invented at the mit media lab by leonardo bonanni, jeff lieberman, cati vaucelle and orit zuckerman leonardo bonanni, jeff lieberman, cati vaucelle, orit zuckerman leonardo bonanni, jeff lieberman, cati vaucelle, orit zuckerman child children communication copresence doll gadget interface kids medialab mit remote robot tangible telepresence toy nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ possessed products Tue, 21 Aug 2007 14:22:11 -0800

Author: amerigo
Added: Tue, 21 Aug 2007 14:22:11 -0800
Duration: 229

this is an art/technology project that tries to embody the ghosts of consumer products in physical form - the radioactive polonium in philip morris cigarettes, the prison labor behind victoria's secret bras and the pollution that goes into apple's ipod.

]]> abuseapplebatterybracigarettesconsumercorporatedesignecologyenvironmentethicsevilipodlabormarlboromorrisphilippollutionpracticeprisonproductsecretsmokevictorias http://revver.com/video/370261/possessed-products/ http://revver.com/watch/370261 possessed products this is an art/technology project that tries to embody the ghosts of consumer products in physical form - the radioactive polonium in philip morris cigarettes, the prison labor behind victoria's secret bras and the pollution that goes into apple's ipod. this is an art/technology project that tries to embody the ghosts of consumer products in physical form - the radioactive polonium in philip morris cigarettes, the prison labor behind victoria's secret bras and the pollution that goes into apple's ipod. leonardo bonanni leonardo bonanni abuse apple battery bra cigarettes consumer corporate design ecology environment ethics evil ipod labor marlboro morris philip pollution practice prison product secret smoke victorias nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ medialab@night Tue, 21 Aug 2007 11:43:08 -0800

Author: amerigo
Added: Tue, 21 Aug 2007 11:43:08 -0800
Duration: 183

since i started working at the M.I.T. medialab, i've always suspected that magical things happen in the wee hours of the morning. i recently uncovered some evidence that only confirms my worst fears.

]]> animationboingboingchipcomputercyborgdollengadgetevilgadgetgzmodomedialabmitplaypalsprostheticprototyperobotsensorstopmotiontangibletechtopobotoy http://revver.com/video/369877/medialabnight/ http://revver.com/watch/369877 medialab@night since i started working at the M.I.T. medialab, i've always suspected that magical things happen in the wee hours of the morning. i recently uncovered some evidence that only confirms my worst fears. since i started working at the M.I.T. medialab, i've always suspected that magical things happen in the wee hours of the morning. i recently uncovered some evidence that only confirms my worst fears. made by leonardo bonanni, music by the cut time players made by leonardo bonanni, music by the cut time players animation boingboing chip computer cyborg doll engadget evil gadget gzmodo medialab mit playpals prosthetic prototype robot sensor stopmotion tangible tech topobo toy nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ one laptop per child XO prototype at siggraph 2007 Tue, 21 Aug 2007 11:43:08 -0800

Author: amerigo
Added: Tue, 21 Aug 2007 11:43:08 -0800
Duration: 394

matthew hockenberry of creativesynthesis.net demonstrates the one laptop per child's fourth production prototype of the 'hundred-dollar laptop' at siggraph 2007 - video by leonardo bonanni of hyperexperience.com FAQ: -Yes, this is the hundred dollar laptop -No, you can't buy one - they are only sold to governments in minimum orders of one million -It actually costs about $140 -It is made by a private non-profit company based in Cambridge MA USA -There is no hand-crank, but a variety of generators are being prototyped including a foot-pedal and a pull-string

]]> acmchildcomputerconferencecountriescreativesynthesisnetdevelopingengadgetgadgetgizmodohyperexperiencelaptoplinuxmedialabmitnon-profitolpconeperprototypesiggraphsugarthirdworldxo http://revver.com/video/369886/one-laptop-per-child-xo-prototype-at-siggraph-2007/ http://revver.com/watch/369886 one laptop per child XO prototype at siggraph 2007 matthew hockenberry of creativesynthesis.net demonstrates the one laptop per child's fourth production prototype of the 'hundred-dollar laptop' at siggraph 2007 - video by leonardo bonanni of hyperexperience.com FAQ: -Yes, this is the hundred dollar laptop -No, you can't buy one - they are only sold to governments in minimum orders of one million -It actually costs about $140 -It is made by a private non-profit company based in Cambridge MA USA -There is no hand-crank, but a variety of generators are being prototyped including a foot-pedal and a pull-string matthew hockenberry of creativesynthesis.net demonstrates the one laptop per child's fourth production prototype of the 'hundred-dollar laptop' at siggraph 2007 - video by leonardo bonanni of hyperexperience.com FAQ: -Yes, this is the hundred dollar laptop -No, you can't buy one - they are only sold to governments in minimum orders of one million -It actually costs about $140 -It is made by a private non-profit company based in Cambridge MA USA -There is no hand-crank, but a variety of generators are being prototyped including a foot-pedal and a pull-string matthew hockenberry, leonardo bonanni matthew hockenberry, leonardo bonanni acm child computer conference countries creativesynthesisnet developing engadget gadget gizmodo hyperexperience laptop linux medialab mit non-profit olpc one per prototype siggraph sugar third world xo nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ dishmaker Tue, 21 Aug 2007 11:43:08 -0800

Author: amerigo
Added: Tue, 21 Aug 2007 11:43:08 -0800
Duration: 226

the dishmaker is a research prototype for a new kitchen appliance that produces different dishes on demand and recycles them once you've finished eating. the dishmaker was designed by leonardo bonanni with mechanical engineer sam sarcia and electrical engineer subodh paudel

]]> appliancebowlscounterintelligencecupsdiahwasherdishesdishmakerfuturegadgetinventioninventorkitchenmedialabmemorymitplasticprototyperecyclingreusesaucersshape http://revver.com/video/369893/dishmaker/ http://revver.com/watch/369893 dishmaker the dishmaker is a research prototype for a new kitchen appliance that produces different dishes on demand and recycles them once you've finished eating. the dishmaker was designed by leonardo bonanni with mechanical engineer sam sarcia and electrical engineer subodh paudel the dishmaker is a research prototype for a new kitchen appliance that produces different dishes on demand and recycles them once you've finished eating. the dishmaker was designed by leonardo bonanni with mechanical engineer sam sarcia and electrical engineer subodh paudel dishmaker by leonardo bonanni, film by paula aguilera dishmaker by leonardo bonanni, film by paula aguilera appliance bowls counterintelligence cups diahwasher dishes dishmaker future gadget invention inventor kitchen medialab memory mit plastic prototype recycling reuse saucers shape nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/