Videos by awesomeone Videos by awesomeone http://revver.com/u/awesomeone/ http://revver.com webmaster@revver.com Fashion Show: Leather Collection Tue, 11 Nov 2008 00:35:37 -0800

Author: awesomeone
Added: Tue, 11 Nov 2008 00:35:37 -0800
Duration: 18

A fashion show I shot. The designer is Tia Paynich.

]]> fashion leather bikini sexy http://revver.com/video/1310267/fashion-show-leather-collection/ http://revver.com/watch/1310267 Fashion Show: Leather Collection A fashion show I shot. The designer is Tia Paynich. A fashion show I shot. The designer is Tia Paynich. awesomeone awesomeone fashion leather bikini sexy nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ motion graphics #2 Mon, 07 Jul 2008 11:22:25 -0800

Author: awesomeone
Added: Mon, 07 Jul 2008 11:22:25 -0800
Duration: 109

A challenge to re-edit archive footage into a explosively colorful music video with a comic book inspired look and feel.

]]> alienmelon http://revver.com/video/1020185/motion-graphics-2/ http://revver.com/watch/1020185 motion graphics #2 A challenge to re-edit archive footage into a explosively colorful music video with a comic book inspired look and feel. A challenge to re-edit archive footage into a explosively colorful music video with a comic book inspired look and feel. AlienMelon AlienMelon alienmelon nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ product concept design Mon, 07 Jul 2008 10:52:33 -0800

Author: awesomeone
Added: Mon, 07 Jul 2008 10:52:33 -0800
Duration: 3

3D product concept design with NewTek’s Lightwave 3D

]]> alienmelon http://revver.com/video/1020124/product-concept-design/ http://revver.com/watch/1020124 product concept design 3D product concept design with NewTek’s Lightwave 3D 3D product concept design with NewTek’s Lightwave 3D AlienMelon AlienMelon alienmelon nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ motion graphics #1 Mon, 07 Jul 2008 10:52:33 -0800

Author: awesomeone
Added: Mon, 07 Jul 2008 10:52:33 -0800
Duration: 43

re-editing challenge. Public domain movies from the classics to obscure cult films mashed up to create a space Sci-Fi/Horror/Comedy.

]]> alienmelon internet archive http://revver.com/video/1020131/motion-graphics-1/ http://revver.com/watch/1020131 motion graphics #1 re-editing challenge. Public domain movies from the classics to obscure cult films mashed up to create a space Sci-Fi/Horror/Comedy. re-editing challenge. Public domain movies from the classics to obscure cult films mashed up to create a space Sci-Fi/Horror/Comedy. AlienMelon AlienMelon alienmelon internet archive nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Gerbil Chroma Key Wed, 25 Jun 2008 17:49:56 -0800

Author: awesomeone
Added: Wed, 25 Jun 2008 17:49:56 -0800
Duration: 18

I shot and edited Gerbils on a blue screen for The Gatekeeper flash game. http://nosebleed.alienmelon.com/gatekeeper

]]> alienmelonblue screenchroma keyediteditoreffectsshootthe gatekeepervideography http://revver.com/video/990629/gerbil-chroma-key/ http://revver.com/watch/990629 Gerbil Chroma Key I shot and edited Gerbils on a blue screen for The Gatekeeper flash game. http://nosebleed.alienmelon.com/gatekeeper I shot and edited Gerbils on a blue screen for The Gatekeeper flash game. http://nosebleed.alienmelon.com/gatekeeper AlienMelon AlienMelon alienmelon blue screen chroma key edit editor effects shoot the gatekeeper videography nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Demo Reel '06 Wed, 09 May 2007 23:28:07 -0800

Author: awesomeone
Added: Wed, 09 May 2007 23:28:07 -0800
Duration: 99

My demo reel of montage awesomeness. I shoot, I edit, I make VFX, sweet motion graphics and run entirely on caffeine and adrenaline. Portfolio: http://www.tanjalawhead.com/scrolling-portfolio-fun Resume: http://www.tanjalawhead.com/TLResume.pdf

]]> alienmelondveditingfilmsgameshdindependentlawheadshootingshorttanjavfxvideovideographyweb http://revver.com/video/264051/demo-reel-06/ http://revver.com/watch/264051 Demo Reel '06 My demo reel of montage awesomeness. I shoot, I edit, I make VFX, sweet motion graphics and run entirely on caffeine and adrenaline. Portfolio: http://www.tanjalawhead.com/scrolling-portfolio-fun Resume: http://www.tanjalawhead.com/TLResume.pdf My demo reel of montage awesomeness. I shoot, I edit, I make VFX, sweet motion graphics and run entirely on caffeine and adrenaline. Portfolio: http://www.tanjalawhead.com/scrolling-portfolio-fun Resume: http://www.tanjalawhead.com/TLResume.pdf AlienMelon, Tanja Lawhead and Yerba Matte Tea AlienMelon, Tanja Lawhead and Yerba Matte Tea alienmelon dv editing films games hd independent lawhead shooting short tanja vfx video videography web nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ TETRAGEDDON : Tetris for us FPS gamers Wed, 18 Apr 2007 23:50:41 -0800

Author: awesomeone
Added: Wed, 18 Apr 2007 23:50:41 -0800
Duration: 96

A trailer for what may possibly be the most awesome game ever to be conceived by man... its better than boiled beer at any rate. Tetris for us FPS gamers: http://nosebleed.alienmelon.com/tetrageddon

]]> alienalienmelonapocalypsearmageddoncasualflashfpsfunnyfunygamegamergameshumormelontetrageddontetristrailervideoweb http://revver.com/video/239387/tetrageddon-tetris-for-us-fps-gamers/ http://revver.com/watch/239387 TETRAGEDDON : Tetris for us FPS gamers A trailer for what may possibly be the most awesome game ever to be conceived by man... its better than boiled beer at any rate. Tetris for us FPS gamers: http://nosebleed.alienmelon.com/tetrageddon A trailer for what may possibly be the most awesome game ever to be conceived by man... its better than boiled beer at any rate. Tetris for us FPS gamers: http://nosebleed.alienmelon.com/tetrageddon AlienMelon AlienMelon alien alienmelon apocalypse armageddon casual flash fps funny funy game gamer games humor melon tetrageddon tetris trailer video web nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ When Johnny Comes Marching Home Fri, 02 Feb 2007 23:57:43 -0800

Author: awesomeone
Added: Fri, 02 Feb 2007 23:57:43 -0800
Duration: 163

When Johnny Comes Marching Home is a satirical silent short film chronicling a day in the school life of an average teen.

]]> comesfilmhomejohnnymarchingmusicsatireschoolshortwar http://revver.com/video/160249/when-johnny-comes-marching-home/ http://revver.com/watch/160249 When Johnny Comes Marching Home When Johnny Comes Marching Home is a satirical silent short film chronicling a day in the school life of an average teen. When Johnny Comes Marching Home is a satirical silent short film chronicling a day in the school life of an average teen. Art Animation and Everything by Nathalie Lawhead Music by Nathalie Lawhead and DJ Lawhead Art Animation and Everything by Nathalie Lawhead Music by Nathalie Lawhead and DJ Lawhead comes film home johnny marching music satire school short war nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Festival Carniola 2006 : Afrikali Sat, 12 Aug 2006 13:50:45 -0800

Author: awesomeone
Added: Sat, 12 Aug 2006 13:50:45 -0800
Duration: 153

Afrikali's performance at Festival Carniola 2006.

]]> africacarnioladancedancerdancingfestivalkranjpartypeopleslovenia http://revver.com/video/47337/festival-carniola-2006-afrikali/ http://revver.com/watch/47337 Festival Carniola 2006 : Afrikali Afrikali's performance at Festival Carniola 2006. Afrikali's performance at Festival Carniola 2006. Afrikali's Myspace: http://www.myspace.com/afrikali Afrikali's Myspace: http://www.myspace.com/afrikali africa carniola dance dancer dancing festival kranj party people slovenia nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Festival Carniola 2006 : Rimpparemmi Sat, 12 Aug 2006 12:57:45 -0800

Author: awesomeone
Added: Sat, 12 Aug 2006 12:57:45 -0800
Duration: 247

Rimpparemmi's Folk Dance Theatre performance at Festival Carniola.

]]> dancefolkslovenia http://revver.com/video/47318/festival-carniola-2006-rimpparemmi/ http://revver.com/watch/47318 Festival Carniola 2006 : Rimpparemmi Rimpparemmi's Folk Dance Theatre performance at Festival Carniola. Rimpparemmi's Folk Dance Theatre performance at Festival Carniola. Rimpparemmi website: http://www.rimpparemmi.com Rimpparemmi website: http://www.rimpparemmi.com dance folk slovenia nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Festival Carniola 2006: Gwen Hughes Sat, 12 Aug 2006 10:25:44 -0800

Author: awesomeone
Added: Sat, 12 Aug 2006 10:25:44 -0800
Duration: 237

Gwen Hughes's performance at Festival Carniola.

]]> carniolafestivalgwenhughesjazzkranjslovenia http://revver.com/video/47232/festival-carniola-2006-gwen-hughes/ http://revver.com/watch/47232 Festival Carniola 2006: Gwen Hughes Gwen Hughes's performance at Festival Carniola. Gwen Hughes's performance at Festival Carniola. Gwen Hughes on vocals, Tomi Puric on drums, Giovanni Toffoloni on bass, Maasej Kovacevich on piano, Robert Vnuk on guitar. Gwen's website: http://www.gwenhughes.com Gwen Hughes on vocals, Tomi Puric on drums, Giovanni Toffoloni on bass, Maasej Kovacevich on piano, Robert Vnuk on guitar. Gwen's website: http://www.gwenhughes.com carniola festival gwen hughes jazz kranj slovenia nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Festival Carniola TV Spot Sat, 12 Aug 2006 10:19:01 -0800

Author: awesomeone
Added: Sat, 12 Aug 2006 10:19:01 -0800
Duration: 93

TV Spot for Festival Carniola 2006. It happens ever summer in Kranj Slovenia.

]]> carnioladancefestivalfolkjazzkranjpartypeopleslovenia http://revver.com/video/47229/festival-carniola-tv-spot/ http://revver.com/watch/47229 Festival Carniola TV Spot TV Spot for Festival Carniola 2006. It happens ever summer in Kranj Slovenia. TV Spot for Festival Carniola 2006. It happens ever summer in Kranj Slovenia. Shot and edited by Tanja Lawhead. Music from Afrikali, remixed by DJ Lawhead. Festival website: http://www.festivalcarniola.com Shot and edited by Tanja Lawhead. Music from Afrikali, remixed by DJ Lawhead. Festival website: http://www.festivalcarniola.com carniola dance festival folk jazz kranj party people slovenia nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Drumguhwhamahee Tue, 08 Aug 2006 14:26:35 -0800

Author: awesomeone
Added: Tue, 08 Aug 2006 14:26:35 -0800
Duration: 182

1958 Portland, Oregon: A strange transmission was being sent through a local TV broadcast station. Televisions across America received a disturbing message. What it was, no one knows to this day. But one thing was for certain; it had to be DESTROYED!

]]> alienaliensdancefashionfunkyfunnyhumorinvasionmusicredunderwearvideoweird http://revver.com/video/45311/drumguhwhamahee/ http://revver.com/watch/45311 Drumguhwhamahee 1958 Portland, Oregon: A strange transmission was being sent through a local TV broadcast station. Televisions across America received a disturbing message. What it was, no one knows to this day. But one thing was for certain; it had to be DESTROYED! 1958 Portland, Oregon: A strange transmission was being sent through a local TV broadcast station. Televisions across America received a disturbing message. What it was, no one knows to this day. But one thing was for certain; it had to be DESTROYED! AlienMelon AlienMelon alien aliens dance fashion funky funny humor invasion music red underwear video weird nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/