Videos by benski2012 Videos by benski2012 http://revver.com/u/benski2012/ http://revver.com webmaster@revver.com ADHD: An Introduction (The Dr. C & Elwood ADHD Series for Children and Families) Wed, 26 Sep 2007 17:09:16 -0800

Author: benski2012
Added: Wed, 26 Sep 2007 17:09:16 -0800
Duration: 50

Dr. C explains to Elwood what ADHD stands for (Attention Deficit Hyperactivity Disorder) in this preview to Dr. C & Elwood's educational ADHD video series for children and families

]]> adhdattentionchildrendefecitdisordereducationalfamiliesfamilyhyperactivitypsychologypuppetrypuppetsventriloquismventriloquist http://revver.com/video/411815/adhd-an-introduction-the-dr-c-elwood-adhd-series-for-children-and-families/ http://revver.com/watch/411815 ADHD: An Introduction (The Dr. C & Elwood ADHD Series for Children and Families) Dr. C explains to Elwood what ADHD stands for (Attention Deficit Hyperactivity Disorder) in this preview to Dr. C & Elwood's educational ADHD video series for children and families Dr. C explains to Elwood what ADHD stands for (Attention Deficit Hyperactivity Disorder) in this preview to Dr. C & Elwood's educational ADHD video series for children and families Written and produced by Dr. Samuel R. Caron, Ph.D. Written and produced by Dr. Samuel R. Caron, Ph.D. adhd attention children defecit disorder educational families family hyperactivity psychology puppetry puppets ventriloquism ventriloquist nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ ADHD: An Introduction (The Dr. C & Elwood ADHD Series for Children and Families) Opening Sequence Wed, 26 Sep 2007 17:09:16 -0800

Author: benski2012
Added: Wed, 26 Sep 2007 17:09:16 -0800
Duration: 56

This is the opening sequence to Dr. C & Elwood's educational ADHD video series for children and families. Call 1-800-993-ADHD (2343) for more information, or go to http://www.adhd1.net/adhd-video.htm

]]> adhdattentionchildrendefecitdisordereducationalfamiliesfamilyhyperactivitypsychologypuppetrypuppetsventriloquismventriloquist http://revver.com/video/411820/adhd-an-introduction-the-dr-c-elwood-adhd-series-for-children-and-families-opening-sequence/ http://revver.com/watch/411820 ADHD: An Introduction (The Dr. C & Elwood ADHD Series for Children and Families) Opening Sequence This is the opening sequence to Dr. C & Elwood's educational ADHD video series for children and families. Call 1-800-993-ADHD (2343) for more information, or go to http://www.adhd1.net/adhd-video.htm This is the opening sequence to Dr. C & Elwood's educational ADHD video series for children and families. Call 1-800-993-ADHD (2343) for more information, or go to http://www.adhd1.net/adhd-video.htm Written and produced by Dr. Samuel R. Caron, Ph.D. Written and produced by Dr. Samuel R. Caron, Ph.D. adhd attention children defecit disorder educational families family hyperactivity psychology puppetry puppets ventriloquism ventriloquist nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ The Fisherman's Clever Daughter Wed, 26 Sep 2007 06:51:18 -0800

Author: benski2012
Added: Wed, 26 Sep 2007 06:51:18 -0800
Duration: 341

full length DVDs available producers/agents, please contact us inquiries: fisherman@adhd1.net Based on Vít Horejš' new translation of an ancient Czech folktale Book by Jeremey Caron Lyrics by Samuel R. Caron, Ph.D. Music by Benjamin J. Caron

]]> fablefairytalefishermanfolktalekingmusicalplayqueentheater http://revver.com/video/411015/the-fishermans-clever-daughter/ http://revver.com/watch/411015 The Fisherman's Clever Daughter full length DVDs available producers/agents, please contact us inquiries: fisherman@adhd1.net Based on Vít Horejš' new translation of an ancient Czech folktale Book by Jeremey Caron Lyrics by Samuel R. Caron, Ph.D. Music by Benjamin J. Caron full length DVDs available producers/agents, please contact us inquiries: fisherman@adhd1.net Based on Vít Horejš' new translation of an ancient Czech folktale Book by Jeremey Caron Lyrics by Samuel R. Caron, Ph.D. Music by Benjamin J. Caron benski2012 benski2012 fable fairytale fisherman folktale king musical play queen theater nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Liquor Abuse PSA Wed, 26 Sep 2007 06:31:40 -0800

Author: benski2012
Added: Wed, 26 Sep 2007 06:31:40 -0800
Duration: 28

Elwood, Steven and Jerry Splinter sing a song to tell children what to do if they are abused by an alcoholic parent

]]> abusealcoholalcoholicchildchildreneducationalfamilyliquorparentspsapuppets http://revver.com/video/410993/liquor-abuse-psa/ http://revver.com/watch/410993 Liquor Abuse PSA Elwood, Steven and Jerry Splinter sing a song to tell children what to do if they are abused by an alcoholic parent Elwood, Steven and Jerry Splinter sing a song to tell children what to do if they are abused by an alcoholic parent Written and produced by Dr. Samuel R. Caron, Ph.D. Written and produced by Dr. Samuel R. Caron, Ph.D. abuse alcohol alcoholic child children educational family liquor parents psa puppets nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Splinter Family Intro Wed, 26 Sep 2007 06:31:40 -0800

Author: benski2012
Added: Wed, 26 Sep 2007 06:31:40 -0800
Duration: 43

Elwood, Steven and Jerry Splinter introduce themselves with a catchy little tune

]]> childrenmusicpuppets http://revver.com/video/410996/splinter-family-intro/ http://revver.com/watch/410996 Splinter Family Intro Elwood, Steven and Jerry Splinter introduce themselves with a catchy little tune Elwood, Steven and Jerry Splinter introduce themselves with a catchy little tune Written and produced by Dr. Samuel R. Caron, Ph.D. Written and produced by Dr. Samuel R. Caron, Ph.D. children music puppets nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Badger as Thumper Wed, 26 Sep 2007 06:31:40 -0800

Author: benski2012
Added: Wed, 26 Sep 2007 06:31:40 -0800
Duration: 61

Badger rubs his tooth on my laptop case and thumps his hind leg.

]]> badgercatcutefunnythumper http://revver.com/video/410997/badger-as-thumper/ http://revver.com/watch/410997 Badger as Thumper Badger rubs his tooth on my laptop case and thumps his hind leg. Badger rubs his tooth on my laptop case and thumps his hind leg. benski2012 benski2012 badger cat cute funny thumper nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/