Videos by driftersdreams Videos by driftersdreams http://revver.com/u/driftersdreams/ http://revver.com webmaster@revver.com perfect drift Fri, 16 May 2008 13:22:30 -0800

Author: driftersdreams
Added: Fri, 16 May 2008 13:22:30 -0800
Duration: 15

This is the example of perfect drift. Tuchia keiichi give the perfect score to this performance. If you do not know how to grade drifting, you can see it is good.

]]> autoautomotivecardriftfujimotivespeedway http://revver.com/video/891595/perfect-drift/ http://revver.com/watch/891595 perfect drift This is the example of perfect drift. Tuchia keiichi give the perfect score to this performance. If you do not know how to grade drifting, you can see it is good. This is the example of perfect drift. Tuchia keiichi give the perfect score to this performance. If you do not know how to grade drifting, you can see it is good. hiroaki koiso hiroaki koiso auto automotive car drift fuji motive speedway nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mac extream Tue, 06 May 2008 11:46:21 -0800

Author: driftersdreams
Added: Tue, 06 May 2008 11:46:21 -0800
Duration: 34

It is Just unboxing episode which went something wrong.

]]> airappleextreammacn http://revver.com/video/867614/mac-extream/ http://revver.com/watch/867614 Mac extream It is Just unboxing episode which went something wrong. It is Just unboxing episode which went something wrong. geektechno.com geektechno.com air apple extream mac n nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Batting Battle Tue, 06 May 2008 11:19:37 -0800

Author: driftersdreams
Added: Tue, 06 May 2008 11:19:37 -0800
Duration: 84

I went to "Batting center". I tried hard but I was not good at it.

]]> ballbaseballbatbatting http://revver.com/video/867462/batting-battle/ http://revver.com/watch/867462 Batting Battle I went to "Batting center". I tried hard but I was not good at it. I went to "Batting center". I tried hard but I was not good at it. hiroakikoiso.org hiroakikoiso.org ball baseball bat batting nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ strange plant Sun, 04 May 2008 01:46:41 -0800

Author: driftersdreams
Added: Sun, 04 May 2008 01:46:41 -0800
Duration: 17

It is called Gokurakuchouka in Japanese. If I translate it in Japanese, it will be heavenly happy bird flawer.

]]> flowerstrange plant plant http://revver.com/video/862337/strange-plant/ http://revver.com/watch/862337 strange plant It is called Gokurakuchouka in Japanese. If I translate it in Japanese, it will be heavenly happy bird flawer. It is called Gokurakuchouka in Japanese. If I translate it in Japanese, it will be heavenly happy bird flawer. H.K H.K flower strange plant plant nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Tokyo driving Sun, 04 May 2008 01:19:32 -0800

Author: driftersdreams
Added: Sun, 04 May 2008 01:19:32 -0800
Duration: 530

I drive tokyo at night. It has great view. Just before sleep you can watch this.

]]> drivefeefree wayhigh wayjapanjapanesekousokunightniteridershibuyashinjukushutokousilviatokyo http://revver.com/video/862307/tokyo-driving/ http://revver.com/watch/862307 Tokyo driving I drive tokyo at night. It has great view. Just before sleep you can watch this. I drive tokyo at night. It has great view. Just before sleep you can watch this. H.K H.K drive fee free way high way japan japanese kousoku night nite rider shibuya shinjuku shutokou silvia tokyo nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Pc project Sat, 03 May 2008 23:49:32 -0800

Author: driftersdreams
Added: Sat, 03 May 2008 23:49:32 -0800
Duration: 133

My computer was loud. I want to have a home sever. So I made it Quiet.

]]> dellgeekpcquiet http://revver.com/video/862202/pc-project/ http://revver.com/watch/862202 Pc project My computer was loud. I want to have a home sever. So I made it Quiet. My computer was loud. I want to have a home sever. So I made it Quiet. H.K H.K dell geek pc quiet nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Strange Atami Stuff Sat, 03 May 2008 21:49:31 -0800

Author: driftersdreams
Added: Sat, 03 May 2008 21:49:31 -0800
Duration: 19

This is the Museum in Atami. It looks strange outside. I am sure it is stranger inside. I did not get in. But next time.

]]> atamibikiniblondbootychellfishgirljapanmar-mademuseumredstarstrangetoplessweird http://revver.com/video/862030/strange-atami-stuff/ http://revver.com/watch/862030 Strange Atami Stuff This is the Museum in Atami. It looks strange outside. I am sure it is stranger inside. I did not get in. But next time. This is the Museum in Atami. It looks strange outside. I am sure it is stranger inside. I did not get in. But next time. H.K H.K atami bikini blond booty chell fish girl japan mar-made museum red star strange topless weird nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ D1 yosen fuji speedway 4 26 Mon, 28 Apr 2008 12:49:33 -0800

Author: driftersdreams
Added: Mon, 28 Apr 2008 12:49:33 -0800
Duration: 111

This is the preliminary of D1. It was exciting

]]> autoautomotivecard1driftdriftersfujimobilnissanpreminalysilviaskylinespeedspeedwaytoyotatrainingvehicle http://revver.com/video/849162/d1-yosen-fuji-speedway-4-26/ http://revver.com/watch/849162 D1 yosen fuji speedway 4 26 This is the preliminary of D1. It was exciting This is the preliminary of D1. It was exciting hiroaki koiso hiroaki koiso auto automotive car d1 drift drifters fuji mobil nissan preminaly silvia skyline speed speedway toyota training vehicle nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Super CAR Sat, 05 Apr 2008 13:19:38 -0800

Author: driftersdreams
Added: Sat, 05 Apr 2008 13:19:38 -0800
Duration: 45

This video is from Tokyo Motor Show

]]> car auto gt-r lexus nissan toy http://revver.com/video/792561/super-car/ http://revver.com/watch/792561 Super CAR This video is from Tokyo Motor Show This video is from Tokyo Motor Show driftersdreams driftersdreams car auto gt-r lexus nissan toy nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ beans Sat, 05 Apr 2008 12:16:24 -0800

Author: driftersdreams
Added: Sat, 05 Apr 2008 12:16:24 -0800
Duration: 62

節分の日に豆まきをしました。

]]> beanbeansfunfunnyinindiaindojapanjapanesenightonipartysetubuntokyo節分 http://revver.com/video/792523/beans/ http://revver.com/watch/792523 beans 節分の日に豆まきをしました。 節分の日に豆まきをしました。 hiroaki koiso hiroaki koiso bean beans fun funny in india indo japan japanese night oni party setubun tokyo 節分 nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Enkaki Mon, 14 Jan 2008 07:36:31 -0800

Author: driftersdreams
Added: Mon, 14 Jan 2008 07:36:31 -0800
Duration: 43

This is my first Enkaki

]]> fuji speed way enkaki drift http://revver.com/video/615782/enkaki/ http://revver.com/watch/615782 Enkaki This is my first Enkaki This is my first Enkaki hiroaki koiso hiroaki koiso fuji speed way enkaki drift nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Snowboarding in Hakuba Goryu Dec 15th 2007 Mon, 17 Dec 2007 09:40:16 -0800

Author: driftersdreams
Added: Mon, 17 Dec 2007 09:40:16 -0800
Duration: 343

I and my friends went to snowboard. Wow that was some snow. We snowboard untill dusk.

]]> snow snowboard http://revver.com/video/532356/snowboarding-in-hakuba-goryu-dec-15th-2007/ http://revver.com/watch/532356 Snowboarding in Hakuba Goryu Dec 15th 2007 I and my friends went to snowboard. Wow that was some snow. We snowboard untill dusk. I and my friends went to snowboard. Wow that was some snow. We snowboard untill dusk. Hiroaki Koiso Hiroaki Koiso snow snowboard nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Cool Toyota cars Sun, 09 Sep 2007 08:26:28 -0800

Author: driftersdreams
Added: Sun, 09 Sep 2007 08:26:28 -0800
Duration: 91

Cool Toyota cars If there is a image which you do not want in public let me know. driftersdreams@gmail.com

]]> autocardriftjapanesetoyota http://revver.com/video/391011/cool-toyota-cars/ http://revver.com/watch/391011 Cool Toyota cars Cool Toyota cars If there is a image which you do not want in public let me know. driftersdreams@gmail.com Cool Toyota cars If there is a image which you do not want in public let me know. driftersdreams@gmail.com hiroaki koiso hiroaki koiso auto car drift japanese toyota nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Drift in slow motion 3 Sun, 09 Sep 2007 04:14:34 -0800

Author: driftersdreams
Added: Sun, 09 Sep 2007 04:14:34 -0800
Duration: 87

You can see more when it is slow. Enjoy

]]> autocarcircuitdriftjapanjapanesemobaras14silviasports http://revver.com/video/390832/drift-in-slow-motion-3/ http://revver.com/watch/390832 Drift in slow motion 3 You can see more when it is slow. Enjoy You can see more when it is slow. Enjoy hiroaki koiso hiroaki koiso auto car circuit drift japan japanese mobara s14 silvia sports nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Drift in slow motion one Sun, 09 Sep 2007 01:44:27 -0800

Author: driftersdreams
Added: Sun, 09 Sep 2007 01:44:27 -0800
Duration: 33

I use shake to change the speed of the video. You can see what`s going on. It is optical flow.

]]> autocardriftmobararains14180silvia http://revver.com/video/390762/drift-in-slow-motion-one/ http://revver.com/watch/390762 Drift in slow motion one I use shake to change the speed of the video. You can see what`s going on. It is optical flow. I use shake to change the speed of the video. You can see what`s going on. It is optical flow. hiroaki koiso hiroaki koiso auto car drift mobara rain s14180 silvia nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Drift in slow motion two Sun, 09 Sep 2007 01:44:27 -0800

Author: driftersdreams
Added: Sun, 09 Sep 2007 01:44:27 -0800
Duration: 62

This is second of the series of video which shake is used. Thank you optical flow.

]]> autodriftflowmobaranissanopticalrains14silviaslow http://revver.com/video/390773/drift-in-slow-motion-two/ http://revver.com/watch/390773 Drift in slow motion two This is second of the series of video which shake is used. Thank you optical flow. This is second of the series of video which shake is used. Thank you optical flow. hiroaki koiso hiroaki koiso auto drift flow mobara nissan optical rain s14 silvia slow nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Speedy drift 3: Rainy day Fri, 07 Sep 2007 10:26:23 -0800

Author: driftersdreams
Added: Fri, 07 Sep 2007 10:26:23 -0800
Duration: 70

Black Silvia S14 The rain was heavy that day. However, I could use less tires. Even though I prefer sunshine over rain. It was fun. Thank you for whatching.

]]> 3autoblackcardaydriftdriftersdreamsimportjapanjapanesemobararains14silviaspeedy http://revver.com/video/389191/speedy-drift-3-rainy-day/ http://revver.com/watch/389191 Speedy drift 3: Rainy day Black Silvia S14 The rain was heavy that day. However, I could use less tires. Even though I prefer sunshine over rain. It was fun. Thank you for whatching. Black Silvia S14 The rain was heavy that day. However, I could use less tires. Even though I prefer sunshine over rain. It was fun. Thank you for whatching. Hiroaki koiso Hiroaki koiso 3 auto black car day drift driftersdreams import japan japanese mobara rain s14 silvia speedy nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Welcome to DriftersDreams.com Thu, 06 Sep 2007 06:26:22 -0800

Author: driftersdreams
Added: Thu, 06 Sep 2007 06:26:22 -0800
Duration: 119

visit at www.driftersdreams.com

]]> autodreamsdriftimportjapanjapaneses14s15silvia http://revver.com/video/387876/welcome-to-driftersdreamscom/ http://revver.com/watch/387876 Welcome to DriftersDreams.com visit at www.driftersdreams.com visit at www.driftersdreams.com hiroaki koiso hiroaki koiso auto dreams drift import japan japanese s14 s15 silvia nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Speedy drift 2 in the rain Wed, 05 Sep 2007 11:35:19 -0800

Author: driftersdreams
Added: Wed, 05 Sep 2007 11:35:19 -0800
Duration: 16

enjoy 86

]]> 86aecardriftdriftingimportsjapanjapaneserainspeedy http://revver.com/video/386533/speedy-drift-2-in-the-rain/ http://revver.com/watch/386533 Speedy drift 2 in the rain enjoy 86 enjoy 86 hiroaki koiso hiroaki koiso 86 ae car drift drifting imports japan japanese rain speedy nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Japanese traffic Tue, 04 Sep 2007 13:05:16 -0800

Author: driftersdreams
Added: Tue, 04 Sep 2007 13:05:16 -0800
Duration: 60

I go somewhere with my car. I just shoot when we use the car. Thank you

]]> autocardriftimportjapanesetokyo http://revver.com/video/385117/japanese-traffic/ http://revver.com/watch/385117 Japanese traffic I go somewhere with my car. I just shoot when we use the car. Thank you I go somewhere with my car. I just shoot when we use the car. Thank you hiroaki koiso hiroaki koiso auto car drift import japanese tokyo nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Japanese auto show girl: The white car Tue, 04 Sep 2007 11:56:15 -0800

Author: driftersdreams
Added: Tue, 04 Sep 2007 11:56:15 -0800
Duration: 9

This car is attractive, beautiful, and smart. Thank you

]]> autocargirlimportsjapanjapaneseshow http://revver.com/video/385049/japanese-auto-show-girl-the-white-car/ http://revver.com/watch/385049 Japanese auto show girl: The white car This car is attractive, beautiful, and smart. Thank you This car is attractive, beautiful, and smart. Thank you driftersdreams driftersdreams auto car girl imports japan japanese show nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Silvia s14 Sun, 02 Sep 2007 06:59:13 -0800

Author: driftersdreams
Added: Sun, 02 Sep 2007 06:59:13 -0800
Duration: 44

This is my friends car. This car is for dirift. I can drift very well. Thanks to the silivia. We can have fun. With music from apple, I hope you can feel this car.

]]> driftsilvia http://revver.com/video/382946/silvia-s14/ http://revver.com/watch/382946 Silvia s14 This is my friends car. This car is for dirift. I can drift very well. Thanks to the silivia. We can have fun. With music from apple, I hope you can feel this car. This is my friends car. This car is for dirift. I can drift very well. Thanks to the silivia. We can have fun. With music from apple, I hope you can feel this car. hiroaki koiso hiroaki koiso drift silvia nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ yet another blue screen of death Sat, 01 Sep 2007 22:35:10 -0800

Author: driftersdreams
Added: Sat, 01 Sep 2007 22:35:10 -0800
Duration: 31

I encounter the blue screen of death. I have not seen thouse for 5 years. with apple demo music, it is nice historical event. I hope I will not encoutner those forever.(I thiki it was beta version of vista. Of course it is beta)

]]> betabluedeathpcwindow http://revver.com/video/382710/yet-another-blue-screen-of-death/ http://revver.com/watch/382710 yet another blue screen of death I encounter the blue screen of death. I have not seen thouse for 5 years. with apple demo music, it is nice historical event. I hope I will not encoutner those forever.(I thiki it was beta version of vista. Of course it is beta) I encounter the blue screen of death. I have not seen thouse for 5 years. with apple demo music, it is nice historical event. I hope I will not encoutner those forever.(I thiki it was beta version of vista. Of course it is beta) hiroaki koiso hiroaki koiso beta blue death pc window nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ hey hey hey Wed, 29 Aug 2007 07:10:18 -0800

Author: driftersdreams
Added: Wed, 29 Aug 2007 07:10:18 -0800
Duration: 5

Hey hey hey hey. That is what they say. It is fun.

]]> autocarfunimports http://revver.com/video/379099/hey-hey-hey/ http://revver.com/watch/379099 hey hey hey Hey hey hey hey. That is what they say. It is fun. Hey hey hey hey. That is what they say. It is fun. driftersdreams driftersdreams auto car fun imports nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ The Z CAR 350 Wed, 29 Aug 2007 06:13:08 -0800

Author: driftersdreams
Added: Wed, 29 Aug 2007 06:13:08 -0800
Duration: 6

This is modified z car. It is cool

]]> autocarimportsjapannissanz http://revver.com/video/379090/the-z-car-350/ http://revver.com/watch/379090 The Z CAR 350 This is modified z car. It is cool This is modified z car. It is cool hiroaki koiso hiroaki koiso auto car imports japan nissan z nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ skyline Tue, 28 Aug 2007 11:40:16 -0800

Author: driftersdreams
Added: Tue, 28 Aug 2007 11:40:16 -0800
Duration: 6

This is 34 skyline. Woo nice.

]]> 34autocardriftjapannissanshowskylineyellow http://revver.com/video/378185/skyline/ http://revver.com/watch/378185 skyline This is 34 skyline. Woo nice. This is 34 skyline. Woo nice. hiroaki koiso hiroaki koiso 34 auto car drift japan nissan show skyline yellow nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ F1 Suzuka Tue, 28 Aug 2007 09:10:16 -0800

Author: driftersdreams
Added: Tue, 28 Aug 2007 09:10:16 -0800
Duration: 27

I went to the F1 in Suzuka 05. I cannot believe this year. The F1 in Japan is no longer held in Suzuka. It will be in Fuji.

]]> f1fujisuzuka http://revver.com/video/378029/f1-suzuka/ http://revver.com/watch/378029 F1 Suzuka I went to the F1 in Suzuka 05. I cannot believe this year. The F1 in Japan is no longer held in Suzuka. It will be in Fuji. I went to the F1 in Suzuka 05. I cannot believe this year. The F1 in Japan is no longer held in Suzuka. It will be in Fuji. hiroaki koiso hiroaki koiso f1 fuji suzuka nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Cool Japanese car Tue, 28 Aug 2007 09:10:16 -0800

Author: driftersdreams
Added: Tue, 28 Aug 2007 09:10:16 -0800
Duration: 14

I do not think those cars are sold in anywhere else but Japan( or some Asian countries maybe) Check it out.

]]> carjapanese http://revver.com/video/378039/cool-japanese-car/ http://revver.com/watch/378039 Cool Japanese car I do not think those cars are sold in anywhere else but Japan( or some Asian countries maybe) Check it out. I do not think those cars are sold in anywhere else but Japan( or some Asian countries maybe) Check it out. hiroaki koiso hiroaki koiso car japanese nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Some Japanese Auto show Tue, 28 Aug 2007 09:10:16 -0800

Author: driftersdreams
Added: Tue, 28 Aug 2007 09:10:16 -0800
Duration: 10

Japan is known for those auto shows. Those girls are just dressed up giving magazine. Very interesting.

]]> autocargirlsimportshow http://revver.com/video/378043/some-japanese-auto-show/ http://revver.com/watch/378043 Some Japanese Auto show Japan is known for those auto shows. Those girls are just dressed up giving magazine. Very interesting. Japan is known for those auto shows. Those girls are just dressed up giving magazine. Very interesting. hiroaki koiso hiroaki koiso auto car girls import show nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Cool shiny car Tue, 28 Aug 2007 08:55:24 -0800

Author: driftersdreams
Added: Tue, 28 Aug 2007 08:55:24 -0800
Duration: 10

This is the car I want

]]> autocarledshow http://revver.com/video/378047/cool-shiny-car/ http://revver.com/watch/378047 Cool shiny car This is the car I want This is the car I want hiroaki koiso hiroaki koiso auto car led show nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ slip drifting Mon, 27 Aug 2007 08:28:13 -0800

Author: driftersdreams
Added: Mon, 27 Aug 2007 08:28:13 -0800
Duration: 17

this is one of my drift video. please enjoy

]]> driftfujiimportjapanese http://revver.com/video/376836/slip-drifting/ http://revver.com/watch/376836 slip drifting this is one of my drift video. please enjoy this is one of my drift video. please enjoy hiroaki koiso hiroaki koiso drift fuji import japanese nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ speedy drift 1 Mon, 27 Aug 2007 08:28:13 -0800

Author: driftersdreams
Added: Mon, 27 Aug 2007 08:28:13 -0800
Duration: 10

This is one of my drift videos in Fuji speed way.

]]> autocardriftimportjapan http://revver.com/video/376840/speedy-drift-1/ http://revver.com/watch/376840 speedy drift 1 This is one of my drift videos in Fuji speed way. This is one of my drift videos in Fuji speed way. hiroaki koiso hiroaki koiso auto car drift import japan nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Tire for drift Sun, 26 Aug 2007 11:34:09 -0800

Author: driftersdreams
Added: Sun, 26 Aug 2007 11:34:09 -0800
Duration: 15

This is the tire, we used in the drifting session

]]> dirftfujiimportjapantire http://revver.com/video/375821/tire-for-drift/ http://revver.com/watch/375821 Tire for drift This is the tire, we used in the drifting session This is the tire, we used in the drifting session hiroaki koiso hiroaki koiso dirft fuji import japan tire nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Fire work summer 2008 Japan Thu, 16 Aug 2007 23:25:14 -0800

Author: driftersdreams
Added: Thu, 16 Aug 2007 23:25:14 -0800
Duration: 39

Fireworks in Japan. I shot this video in the rever bank. Thank You

]]> firefireworksflyjapansummer http://revver.com/video/365320/fire-work-summer-2008-japan/ http://revver.com/watch/365320 Fire work summer 2008 Japan Fireworks in Japan. I shot this video in the rever bank. Thank You Fireworks in Japan. I shot this video in the rever bank. Thank You hiroaki koiso hiroaki koiso fire fireworks fly japan summer nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Smooth cam Union result Tue, 14 Aug 2007 22:43:06 -0800

Author: driftersdreams
Added: Tue, 14 Aug 2007 22:43:06 -0800
Duration: 18

This is the result of smooth cam

]]> driftsilviasmoothcam http://revver.com/video/363192/smooth-cam-union-result/ http://revver.com/watch/363192 Smooth cam Union result This is the result of smooth cam This is the result of smooth cam 小磯　宏明 小磯　宏明 drift silvia smoothcam nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ SmoothCam Video Souce Tue, 14 Aug 2007 09:43:07 -0800

Author: driftersdreams
Added: Tue, 14 Aug 2007 09:43:07 -0800
Duration: 14

This is shakey video. If we use smooth Can how things turned out.

]]> driftdriftersdreamssilviasmoothcam http://revver.com/video/362625/smoothcam-video-souce/ http://revver.com/watch/362625 SmoothCam Video Souce This is shakey video. If we use smooth Can how things turned out. This is shakey video. If we use smooth Can how things turned out. Hiroaki Koiso Hiroaki Koiso drift driftersdreams silvia smoothcam nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Uncut Wed, 02 May 2007 10:34:08 -0800

Author: driftersdreams
Added: Wed, 02 May 2007 10:34:08 -0800
Duration: 325

This video is one sequence that I did not edit. Therefore, you can see the entire circuit. Enjoy.

]]> blackimportjapanjapaneses14silviatunner http://revver.com/video/254874/uncut/ http://revver.com/watch/254874 Uncut This video is one sequence that I did not edit. Therefore, you can see the entire circuit. Enjoy. This video is one sequence that I did not edit. Therefore, you can see the entire circuit. Enjoy. hiroaki koiso hiroaki koiso black import japan japanese s14 silvia tunner nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ TeaserThree Wed, 02 May 2007 08:04:08 -0800

Author: driftersdreams
Added: Wed, 02 May 2007 08:04:08 -0800
Duration: 12

Visit www.silviadrifts.com

]]> autoautomotiveblackcardriftdriftingmobarasilviaspeed waysports cartwin http://revver.com/video/254778/teaserthree/ http://revver.com/watch/254778 TeaserThree Visit www.silviadrifts.com Visit www.silviadrifts.com hiroaki koiso hiroaki koiso auto automotive black car drift drifting mobara silvia speed way sports car twin nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ TeaserTwo Wed, 02 May 2007 06:13:07 -0800

Author: driftersdreams
Added: Wed, 02 May 2007 06:13:07 -0800
Duration: 16

Please visit our website. www.silviadrifts.com

]]> autoautomotivecardriftsimportimportsjapanjapanesemobarasiliviaspeed waytunner http://revver.com/video/254608/teasertwo/ http://revver.com/watch/254608 TeaserTwo Please visit our website. www.silviadrifts.com Please visit our website. www.silviadrifts.com hiroaki koiso hiroaki koiso auto automotive car drifts import imports japan japanese mobara silivia speed way tunner nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ TeaserOne Wed, 02 May 2007 05:52:15 -0800

Author: driftersdreams
Added: Wed, 02 May 2007 05:52:15 -0800
Duration: 15

Please Visit www.silviadrifts.com You can see the series of Black Silvia drifting.

]]> autoautomotiveblackcardriftimport tunerjapanjapanesemobaras14silviaspeed waytuner http://revver.com/video/254541/teaserone/ http://revver.com/watch/254541 TeaserOne Please Visit www.silviadrifts.com You can see the series of Black Silvia drifting. Please Visit www.silviadrifts.com You can see the series of Black Silvia drifting. Hiroaki Koiso Hiroaki Koiso auto automotive black car drift import tuner japan japanese mobara s14 silvia speed way tuner nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ From Inside Tue, 01 May 2007 16:49:05 -0800

Author: driftersdreams
Added: Tue, 01 May 2007 16:49:05 -0800
Duration: 124

I just ride on Black Silvia S14 while it is drifting. This was cool experience. I had a lot of fun. I hope this video shows how it will be inside of the car of drifting. Thank you.

]]> blackcardriftfujis14silvia http://revver.com/video/254067/from-inside/ http://revver.com/watch/254067 From Inside I just ride on Black Silvia S14 while it is drifting. This was cool experience. I had a lot of fun. I hope this video shows how it will be inside of the car of drifting. Thank you. I just ride on Black Silvia S14 while it is drifting. This was cool experience. I had a lot of fun. I hope this video shows how it will be inside of the car of drifting. Thank you. Hiroaki Koiso Hiroaki Koiso black car drift fuji s14 silvia nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ MacBookUnboxed Tue, 01 May 2007 14:19:05 -0800

Author: driftersdreams
Added: Tue, 01 May 2007 14:19:05 -0800
Duration: 105

I just bought a Mac.

]]> macbooktechunboxedunboxing http://revver.com/video/253899/macbookunboxed/ http://revver.com/watch/253899 MacBookUnboxed I just bought a Mac. I just bought a Mac. hiroaki koiso hiroaki koiso macbook tech unboxed unboxing nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Drifting In Japan Thu, 18 Jan 2007 08:31:51 -0800

Author: driftersdreams
Added: Thu, 18 Jan 2007 08:31:51 -0800
Duration: 28

People in Japan drift even in the rain. This car is Nissan silvia S14 which is still cool reawheel drive car. Please enjoy. I will continue posting drift videos.

]]> cardriftimportjapanmodnissanracerainreawheels14silviaspeedtiretokyotunetunner http://revver.com/video/144212/drifting-in-japan/ http://revver.com/watch/144212 Drifting In Japan People in Japan drift even in the rain. This car is Nissan silvia S14 which is still cool reawheel drive car. Please enjoy. I will continue posting drift videos. People in Japan drift even in the rain. This car is Nissan silvia S14 which is still cool reawheel drive car. Please enjoy. I will continue posting drift videos. HIroaki koiso HIroaki koiso car drift import japan mod nissan race rain reawheel s14 silvia speed tire tokyo tune tunner nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/