Videos by eldon Videos by eldon http://revver.com/u/eldon/ http://revver.com webmaster@revver.com Cardboard Boat Pictures and Movies Tue, 09 Dec 2008 18:50:01 -0800

Author: eldon
Added: Tue, 09 Dec 2008 18:50:01 -0800
Duration: 200

A compilation of pictures and movies taken of my cardboard boat.

]]> boatcardboardgroundslakemcconnellsburgmeadowpaper http://revver.com/video/1369451/cardboard-boat-pictures-and-movies/ http://revver.com/watch/1369451 Cardboard Boat Pictures and Movies A compilation of pictures and movies taken of my cardboard boat. A compilation of pictures and movies taken of my cardboard boat. By Eldon Martin By Eldon Martin boat cardboard grounds lake mcconnellsburg meadow paper nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Porkey's Midnight Matinee Tue, 25 Nov 2008 22:52:35 -0800

Author: eldon
Added: Tue, 25 Nov 2008 22:52:35 -0800
Duration: 463

A classic cartoon featuring Porky

]]> cartoonmatineemidnightpigporkeytooncrazy http://revver.com/video/1341408/porkeys-midnight-matinee/ http://revver.com/watch/1341408 Porkey's Midnight Matinee A classic cartoon featuring Porky A classic cartoon featuring Porky eldon eldon cartoon matinee midnight pig porkey tooncrazy nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Cardboard Boat Part 2 Thu, 18 Sep 2008 20:36:39 -0800

Author: eldon
Added: Thu, 18 Sep 2008 20:36:39 -0800
Duration: 103

My cardboard boat takes it's first voyage on Meadow Grounds Lake near McConnellsburg, PA. The boat is made entirely of cardboard and paper, held together by tape and glue, and sealed with varnish.

]]> boatcardboardgroundslakemcconnellsburgmeadowpaper http://revver.com/video/1186891/cardboard-boat-part-2/ http://revver.com/watch/1186891 Cardboard Boat Part 2 My cardboard boat takes it's first voyage on Meadow Grounds Lake near McConnellsburg, PA. The boat is made entirely of cardboard and paper, held together by tape and glue, and sealed with varnish. My cardboard boat takes it's first voyage on Meadow Grounds Lake near McConnellsburg, PA. The boat is made entirely of cardboard and paper, held together by tape and glue, and sealed with varnish. Produced by Eldon Martin Produced by Eldon Martin boat cardboard grounds lake mcconnellsburg meadow paper nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Betty Boop - Snow White Sun, 07 Sep 2008 22:55:21 -0800

Author: eldon
Added: Sun, 07 Sep 2008 22:55:21 -0800
Duration: 433

An animated classic.

]]> bettyboopcartoonclassicsnowtooncrazywhite http://revver.com/video/1159829/betty-boop-snow-white/ http://revver.com/watch/1159829 Betty Boop - Snow White An animated classic. An animated classic. eldon eldon betty boop cartoon classic snow tooncrazy white nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Popeye - Blow me down Sun, 07 Sep 2008 22:55:21 -0800

Author: eldon
Added: Sun, 07 Sep 2008 22:55:21 -0800
Duration: 388

Popeye meets the old west

]]> actionblowblutogunpopeyewestern http://revver.com/video/1159834/popeye-blow-me-down/ http://revver.com/watch/1159834 Popeye - Blow me down Popeye meets the old west Popeye meets the old west eldon eldon action blow bluto gun popeye western nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Popeye - Fright to the Finish Sun, 07 Sep 2008 22:55:21 -0800

Author: eldon
Added: Sun, 07 Sep 2008 22:55:21 -0800
Duration: 391

Bluto and Popeye involved in a scary competition

]]> blutofinishfrightoilolivepopeye http://revver.com/video/1159841/popeye-fright-to-the-finish/ http://revver.com/watch/1159841 Popeye - Fright to the Finish Bluto and Popeye involved in a scary competition Bluto and Popeye involved in a scary competition eldon eldon bluto finish fright oil olive popeye nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Popeye - The Paneless Windows Washer Sun, 07 Sep 2008 22:55:21 -0800

Author: eldon
Added: Sun, 07 Sep 2008 22:55:21 -0800
Duration: 1078

A Popeye animated classic.

]]> cartoonclassicpopeye http://revver.com/video/1159865/popeye-the-paneless-windows-washer/ http://revver.com/watch/1159865 Popeye - The Paneless Windows Washer A Popeye animated classic. A Popeye animated classic. eldon eldon cartoon classic popeye nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Popeye - Patriotic Popeye Sun, 07 Sep 2008 22:55:21 -0800

Author: eldon
Added: Sun, 07 Sep 2008 22:55:21 -0800
Duration: 372

An animated classic.

]]> cartoonclassicpatrioticpopeye http://revver.com/video/1159871/popeye-patriotic-popeye/ http://revver.com/watch/1159871 Popeye - Patriotic Popeye An animated classic. An animated classic. eldon eldon cartoon classic patriotic popeye nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Popeye - Shuteye Popeye Sun, 07 Sep 2008 13:55:21 -0800

Author: eldon
Added: Sun, 07 Sep 2008 13:55:21 -0800
Duration: 375

A mouse and Popeye engage in a humorous battle for snoring rights.

]]> cartoonfunnymousepopeyeshuteyetooncrazy http://revver.com/video/1159071/popeye-shuteye-popeye/ http://revver.com/watch/1159071 Popeye - Shuteye Popeye A mouse and Popeye engage in a humorous battle for snoring rights. A mouse and Popeye engage in a humorous battle for snoring rights. eldon eldon cartoon funny mouse popeye shuteye tooncrazy nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Merrie Melodies: The Early Worm Gets the Bird Fri, 29 Aug 2008 22:54:27 -0800

Author: eldon
Added: Fri, 29 Aug 2008 22:54:27 -0800
Duration: 520

A determined bird goes out early to hunt for a worm and the bird gets into trouble. Produced in 1939 and now in the public domain.

]]> birdcartoonmerrie melodiestooncrazyworm http://revver.com/video/1140505/merrie-melodies-the-early-worm-gets-the-bird/ http://revver.com/watch/1140505 Merrie Melodies: The Early Worm Gets the Bird A determined bird goes out early to hunt for a worm and the bird gets into trouble. Produced in 1939 and now in the public domain. A determined bird goes out early to hunt for a worm and the bird gets into trouble. Produced in 1939 and now in the public domain. eldon eldon bird cartoon merrie melodies tooncrazy worm nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Merrie Melodies: Falling Hare Fri, 29 Aug 2008 22:54:27 -0800

Author: eldon
Added: Fri, 29 Aug 2008 22:54:27 -0800
Duration: 515

Bugs Bunny goes to a military base where he meets up with a mischievous gremlin who gets the better of him. Produced in 1943 and now in the public domain.

]]> bugsbunnyfallinghare http://revver.com/video/1140616/merrie-melodies-falling-hare/ http://revver.com/watch/1140616 Merrie Melodies: Falling Hare Bugs Bunny goes to a military base where he meets up with a mischievous gremlin who gets the better of him. Produced in 1943 and now in the public domain. Bugs Bunny goes to a military base where he meets up with a mischievous gremlin who gets the better of him. Produced in 1943 and now in the public domain. eldon eldon bugs bunny falling hare nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Merrie Melodies: Fresh Hare Fri, 29 Aug 2008 22:54:27 -0800

Author: eldon
Added: Fri, 29 Aug 2008 22:54:27 -0800
Duration: 462

Bugs Bunny is wanted by the police.

]]> cartonfreshharemelodiesmerriemerrytooncrazy.tv http://revver.com/video/1140643/merrie-melodies-fresh-hare/ http://revver.com/watch/1140643 Merrie Melodies: Fresh Hare Bugs Bunny is wanted by the police. Bugs Bunny is wanted by the police. eldon eldon carton fresh hare melodies merrie merry tooncrazy.tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Noveltoon: Naughty but Mice Fri, 29 Aug 2008 22:54:27 -0800

Author: eldon
Added: Fri, 29 Aug 2008 22:54:27 -0800
Duration: 410

Mice use the services of an outside consultant in their efforts to be rid of the cat.

]]> cartoonmicenoveltoontooncrazy http://revver.com/video/1140663/noveltoon-naughty-but-mice/ http://revver.com/watch/1140663 Noveltoon: Naughty but Mice Mice use the services of an outside consultant in their efforts to be rid of the cat. Mice use the services of an outside consultant in their efforts to be rid of the cat. eldon eldon cartoon mice noveltoon tooncrazy nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Noveltoon: Tarts and Flowers Wed, 27 Aug 2008 11:56:37 -0800

Author: eldon
Added: Wed, 27 Aug 2008 11:56:37 -0800
Duration: 430

A cartoon about dreams, gingerbread men, and more. This film was produced in 1950 and is now in the public domain.

]]> 1950animatedcartonclassicfilmflowersmovienoveltoonoldtarts http://revver.com/video/1135089/noveltoon-tarts-and-flowers/ http://revver.com/watch/1135089 Noveltoon: Tarts and Flowers A cartoon about dreams, gingerbread men, and more. This film was produced in 1950 and is now in the public domain. A cartoon about dreams, gingerbread men, and more. This film was produced in 1950 and is now in the public domain. eldon eldon 1950 animated carton classic film flowers movie noveltoon old tarts nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ The first voyage of my cardboard boat Tue, 19 Aug 2008 19:54:57 -0800

Author: eldon
Added: Tue, 19 Aug 2008 19:54:57 -0800
Duration: 80

My boat meets the water for the first time. The boat is made entirely of cardboard and paper, held together by tape and glue, and sealed with varnish.

]]> bernardoblogboatcardboardfultonpapapertech http://revver.com/video/1119517/the-first-voyage-of-my-cardboard-boat/ http://revver.com/watch/1119517 The first voyage of my cardboard boat My boat meets the water for the first time. The boat is made entirely of cardboard and paper, held together by tape and glue, and sealed with varnish. My boat meets the water for the first time. The boat is made entirely of cardboard and paper, held together by tape and glue, and sealed with varnish. Produced by Eldon Martin Produced by Eldon Martin bernardo blog boat cardboard fulton pa paper tech nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Demolition Derby Sun, 17 Aug 2008 20:35:29 -0800

Author: eldon
Added: Sun, 17 Aug 2008 20:35:29 -0800
Duration: 244

Watch cars smash into each other at the 2008 Demolition Derby held at the Fulton County Fair in McConnellsburg, Pennsylvania

]]> accidentautocarcrashdemoderbyfultonpapennsylvania http://revver.com/video/1115138/demolition-derby/ http://revver.com/watch/1115138 Demolition Derby Watch cars smash into each other at the 2008 Demolition Derby held at the Fulton County Fair in McConnellsburg, Pennsylvania Watch cars smash into each other at the 2008 Demolition Derby held at the Fulton County Fair in McConnellsburg, Pennsylvania Produced by Eldon Martin Produced by Eldon Martin accident auto car crash demo derby fulton pa pennsylvania nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Spotted Fawns Playing Sun, 17 Aug 2008 15:54:38 -0800

Author: eldon
Added: Sun, 17 Aug 2008 15:54:38 -0800
Duration: 64

Whitetail fawns playing near the woods. Filmed near McConnellsburg in Fulton County, Pennsylvania.

]]> deerfawnsfultonmcconnellsburgpapennsylvaniaspottedwhitetailwoods http://revver.com/video/1114770/spotted-fawns-playing/ http://revver.com/watch/1114770 Spotted Fawns Playing Whitetail fawns playing near the woods. Filmed near McConnellsburg in Fulton County, Pennsylvania. Whitetail fawns playing near the woods. Filmed near McConnellsburg in Fulton County, Pennsylvania. Produced by Eldon Martin Produced by Eldon Martin deer fawns fulton mcconnellsburg pa pennsylvania spotted whitetail woods nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Animals of the 2008 Fulton County Fair Sat, 16 Aug 2008 20:35:20 -0800

Author: eldon
Added: Sat, 16 Aug 2008 20:35:20 -0800
Duration: 69

Video clips of various animals at the 2008 Fulton County Fair in McConnellsburg, Pennsylvania.

]]> countycowfairfultongoathorsepapennsylvaniapigrabbitsheep http://revver.com/video/1113678/animals-of-the-2008-fulton-county-fair/ http://revver.com/watch/1113678 Animals of the 2008 Fulton County Fair Video clips of various animals at the 2008 Fulton County Fair in McConnellsburg, Pennsylvania. Video clips of various animals at the 2008 Fulton County Fair in McConnellsburg, Pennsylvania. Produced by Eldon Martin Produced by Eldon Martin county cow fair fulton goat horse pa pennsylvania pig rabbit sheep nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Fireworks at the 2008 Fulton County Fair Sat, 16 Aug 2008 20:35:20 -0800

Author: eldon
Added: Sat, 16 Aug 2008 20:35:20 -0800
Duration: 63

Fireworks light the night sky at the 2008 Fulton County Fair in McConnellsburg, Pennsylvania.

]]> 2008countyfairfireworksfultonmcconnellsburgpapennsylvania http://revver.com/video/1113326/fireworks-at-the-2008-fulton-county-fair/ http://revver.com/watch/1113326 Fireworks at the 2008 Fulton County Fair Fireworks light the night sky at the 2008 Fulton County Fair in McConnellsburg, Pennsylvania. Fireworks light the night sky at the 2008 Fulton County Fair in McConnellsburg, Pennsylvania. Produced by Eldon Martin Produced by Eldon Martin 2008 county fair fireworks fulton mcconnellsburg pa pennsylvania nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Waterfall Near Meadow Grounds Lake Tue, 12 Aug 2008 03:54:06 -0800

Author: eldon
Added: Tue, 12 Aug 2008 03:54:06 -0800
Duration: 21

Video clips of the waterfall at Meadow Grounds Lake, near McConnellsburg in Fulton County Pennsylvania.

]]> countyfultonlakemeadow groundspapennsylvaniawaterfall http://revver.com/video/1102708/waterfall-near-meadow-grounds-lake/ http://revver.com/watch/1102708 Waterfall Near Meadow Grounds Lake Video clips of the waterfall at Meadow Grounds Lake, near McConnellsburg in Fulton County Pennsylvania. Video clips of the waterfall at Meadow Grounds Lake, near McConnellsburg in Fulton County Pennsylvania. Filmed by Eldon Martin Filmed by Eldon Martin county fulton lake meadow grounds pa pennsylvania waterfall nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Lawn Mower Racing 2008 Sun, 29 Jun 2008 15:24:37 -0800

Author: eldon
Added: Sun, 29 Jun 2008 15:24:37 -0800
Duration: 60

Video clips of the lawn mower races held on June 28, 2008 at the Fulton County Fairgrounds in McConnellsburg, Pennsylvania.

]]> countyfultonlawnmcconnellsburgmowerpapennsylvaniaraceracing http://revver.com/video/1000337/lawn-mower-racing-2008/ http://revver.com/watch/1000337 Lawn Mower Racing 2008 Video clips of the lawn mower races held on June 28, 2008 at the Fulton County Fairgrounds in McConnellsburg, Pennsylvania. Video clips of the lawn mower races held on June 28, 2008 at the Fulton County Fairgrounds in McConnellsburg, Pennsylvania. Produced by Eldon Martin Produced by Eldon Martin county fulton lawn mcconnellsburg mower pa pennsylvania race racing nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Myers Motors NMG electric vehicle Wed, 28 Nov 2007 10:04:06 -0800

Author: eldon
Added: Wed, 28 Nov 2007 10:04:06 -0800
Duration: 29

A few slides and video of the Myers Motors NMG (no more gas) electric vehicle. Formerly called the Corbin Sparrow, this 3-wheeled vehicle can travel 75 MPG.

]]> corbinelectrci vehicleevmortorsmyersnmgsparrow http://revver.com/video/502356/myers-motors-nmg-electric-vehicle/ http://revver.com/watch/502356 Myers Motors NMG electric vehicle A few slides and video of the Myers Motors NMG (no more gas) electric vehicle. Formerly called the Corbin Sparrow, this 3-wheeled vehicle can travel 75 MPG. A few slides and video of the Myers Motors NMG (no more gas) electric vehicle. Formerly called the Corbin Sparrow, this 3-wheeled vehicle can travel 75 MPG. Filmed by Eldon Martin Filmed by Eldon Martin corbin electrci vehicle ev mortors myers nmg sparrow nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Spike Buck Wed, 28 Nov 2007 10:04:06 -0800

Author: eldon
Added: Wed, 28 Nov 2007 10:04:06 -0800
Duration: 40

A spike buck is spotted by hunters in Pennsylvania

]]> buckfultonhuntingpapennsylvaniaspikewhitetail http://revver.com/video/502363/spike-buck/ http://revver.com/watch/502363 Spike Buck A spike buck is spotted by hunters in Pennsylvania A spike buck is spotted by hunters in Pennsylvania Filmed by Titus Martin Filmed by Titus Martin buck fulton hunting pa pennsylvania spike whitetail nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Battle for Wesnoth Trailer Thu, 04 Oct 2007 08:36:35 -0800

Author: eldon
Added: Thu, 04 Oct 2007 08:36:35 -0800
Duration: 76

A video trailer for the popular computer game Battle for Wesnoth. The game is free and available for Windows, Linux, and the Mac. Because it is open-source, you can legally download it and share it with your friends!

]]> battlecomputerfantasyfreegamemultiplayerplayingrolerpgtrailerwesnoth http://revver.com/video/421888/battle-for-wesnoth-trailer/ http://revver.com/watch/421888 Battle for Wesnoth Trailer A video trailer for the popular computer game Battle for Wesnoth. The game is free and available for Windows, Linux, and the Mac. Because it is open-source, you can legally download it and share it with your friends! A video trailer for the popular computer game Battle for Wesnoth. The game is free and available for Windows, Linux, and the Mac. Because it is open-source, you can legally download it and share it with your friends! eldon eldon battle computer fantasy free game multiplayer playing role rpg trailer wesnoth nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Canadian Geese Wed, 05 Sep 2007 19:35:20 -0800

Author: eldon
Added: Wed, 05 Sep 2007 19:35:20 -0800
Duration: 22

Canadian geese on the shores of Tappan Lake along route 250 in Ohio

]]> canadiangeeseohio http://revver.com/video/386980/canadian-geese/ http://revver.com/watch/386980 Canadian Geese Canadian geese on the shores of Tappan Lake along route 250 in Ohio Canadian geese on the shores of Tappan Lake along route 250 in Ohio Filmed by Eldon Martin Filmed by Eldon Martin canadian geese ohio nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Lawn Mower Racing Sat, 25 Aug 2007 18:10:27 -0800

Author: eldon
Added: Sat, 25 Aug 2007 18:10:27 -0800
Duration: 22

Lawn mowers race at the 2006 Fair in Fulton County, Pennsylvania.

]]> countyfairfultonlawnmowerpennsylvaniaraceracing http://revver.com/video/375031/lawn-mower-racing/ http://revver.com/watch/375031 Lawn Mower Racing Lawn mowers race at the 2006 Fair in Fulton County, Pennsylvania. Lawn mowers race at the 2006 Fair in Fulton County, Pennsylvania. Filmed by Eldon Martin Filmed by Eldon Martin county fair fulton lawn mower pennsylvania race racing nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Electric Cars at Power of DC 2007 Wed, 06 Jun 2007 06:43:10 -0800

Author: eldon
Added: Wed, 06 Jun 2007 06:43:10 -0800
Duration: 66

Photos and video clips of several electric cars at Power of DC 2007 in Hagerstown, MD.

]]> cardcelectricevhagerstownmdpowervehicle http://revver.com/video/292264/electric-cars-at-power-of-dc-2007/ http://revver.com/watch/292264 Electric Cars at Power of DC 2007 Photos and video clips of several electric cars at Power of DC 2007 in Hagerstown, MD. Photos and video clips of several electric cars at Power of DC 2007 in Hagerstown, MD. Produced by Eldon Martin Produced by Eldon Martin car dc electric ev hagerstown md power vehicle nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Corbin Sparrow Electric Car Sun, 03 Jun 2007 13:13:06 -0800

Author: eldon
Added: Sun, 03 Jun 2007 13:13:06 -0800
Duration: 48

A Corbin Sparrow electric car checks out the track at the "Power of DC" event in Hagerstown, MD on June 2, 2007.

]]> carcorbinelectricevmotorsmyersnmgsparrowvehicle http://revver.com/video/288803/corbin-sparrow-electric-car/ http://revver.com/watch/288803 Corbin Sparrow Electric Car A Corbin Sparrow electric car checks out the track at the "Power of DC" event in Hagerstown, MD on June 2, 2007. A Corbin Sparrow electric car checks out the track at the "Power of DC" event in Hagerstown, MD on June 2, 2007. Produced by Eldon Martin Produced by Eldon Martin car corbin electric ev motors myers nmg sparrow vehicle nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Whitetail bucks in velvet Sat, 24 Feb 2007 09:35:07 -0800

Author: eldon
Added: Sat, 24 Feb 2007 09:35:07 -0800
Duration: 126

A group of five whitetail deer playing in a field. All are bucks with short antlers, still in velvet. Video shot in Fulton County, PA.

]]> antlersbucksdeerfultonpavelvetwhitetail http://revver.com/video/184706/whitetail-bucks-in-velvet/ http://revver.com/watch/184706 Whitetail bucks in velvet A group of five whitetail deer playing in a field. All are bucks with short antlers, still in velvet. Video shot in Fulton County, PA. A group of five whitetail deer playing in a field. All are bucks with short antlers, still in velvet. Video shot in Fulton County, PA. Eldon Martin Eldon Martin antlers bucks deer fulton pa velvet whitetail nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Dog Tricks Fri, 23 Feb 2007 18:32:54 -0800

Author: eldon
Added: Fri, 23 Feb 2007 18:32:54 -0800
Duration: 42

A dog rolls over and plays dead.

]]> dogtrick http://revver.com/video/183745/dog-tricks/ http://revver.com/watch/183745 Dog Tricks A dog rolls over and plays dead. A dog rolls over and plays dead. eldon eldon dog trick nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Coal Mine Canyon - Arizona Mon, 19 Feb 2007 10:56:52 -0800

Author: eldon
Added: Mon, 19 Feb 2007 10:56:52 -0800
Duration: 45

A video of a little-known canyon in Arizona - beautiful red and white rocks.

]]> arizonacanyoncoalmine http://revver.com/video/178579/coal-mine-canyon-arizona/ http://revver.com/watch/178579 Coal Mine Canyon - Arizona A video of a little-known canyon in Arizona - beautiful red and white rocks. A video of a little-known canyon in Arizona - beautiful red and white rocks. Eldon Martin Eldon Martin arizona canyon coal mine nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Grand Canyon Mon, 19 Feb 2007 01:05:41 -0800

Author: eldon
Added: Mon, 19 Feb 2007 01:05:41 -0800
Duration: 98

A few video clips of the Grand Canyon

]]> arizonacanyongrand http://revver.com/video/178177/grand-canyon/ http://revver.com/watch/178177 Grand Canyon A few video clips of the Grand Canyon A few video clips of the Grand Canyon Eldon Martin Eldon Martin arizona canyon grand nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Meadow Grounds Lake Waterfall Mon, 19 Feb 2007 00:05:43 -0800

Author: eldon
Added: Mon, 19 Feb 2007 00:05:43 -0800
Duration: 12

This is a video of a waterfall located near Meadow Grounds Lake in Fulton County, Pennsylvania.

]]> fultongroundsmcconnellsburgmeadowpennsylvaniawaterfall http://revver.com/video/178100/meadow-grounds-lake-waterfall/ http://revver.com/watch/178100 Meadow Grounds Lake Waterfall This is a video of a waterfall located near Meadow Grounds Lake in Fulton County, Pennsylvania. This is a video of a waterfall located near Meadow Grounds Lake in Fulton County, Pennsylvania. Eldon Martin Eldon Martin fulton grounds mcconnellsburg meadow pennsylvania waterfall nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Fulton Festival Parade 2006 Sun, 18 Feb 2007 13:02:39 -0800

Author: eldon
Added: Sun, 18 Feb 2007 13:02:39 -0800
Duration: 133

A few highlights from the Fulton County, PA fall folk festival parade.

]]> fallfestivalfolkfultonpaparadepennsylvania http://revver.com/video/177895/fulton-festival-parade-2006/ http://revver.com/watch/177895 Fulton Festival Parade 2006 A few highlights from the Fulton County, PA fall folk festival parade. A few highlights from the Fulton County, PA fall folk festival parade. Eldon Martin Eldon Martin fall festival folk fulton pa parade pennsylvania nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Deer hunting in Fulton County Mon, 07 Nov 2005 05:15:59 -0800

Author: eldon
Added: Mon, 07 Nov 2005 05:15:59 -0800
Duration: 136

a hunter harvests a deer with bow and arrow

]]> archeryarrowbowdeerharvesthuntingkill http://revver.com/video/2662/deer-hunting-in-fulton-county/ http://revver.com/watch/2662 Deer hunting in Fulton County a hunter harvests a deer with bow and arrow a hunter harvests a deer with bow and arrow Eldon Martin Eldon Martin archery arrow bow deer harvest hunting kill nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/