Videos by fdpfilms Videos by fdpfilms http://revver.com/u/fdpfilms/ http://revver.com webmaster@revver.com Millard & Blake Thu, 08 Nov 2007 16:55:07 -0800

Author: fdpfilms
Added: Thu, 08 Nov 2007 16:55:07 -0800
Duration: 334

Town superheroes Millard & Blake combat the evil Dinosaur and other evildoers to save Anytown, USA, from evil. This film showed at SIFF, the Student Independent Film Festival in August 2007!

]]> alexabatmanbattlecapedinodinosaurdragonfdpfilm festivalfirefuzzy dice productionsindependentlaserprotectsavesiffspidermanstudentsuperherosupermanworld http://revver.com/video/474475/millard-blake/ http://revver.com/watch/474475 Millard & Blake Town superheroes Millard & Blake combat the evil Dinosaur and other evildoers to save Anytown, USA, from evil. This film showed at SIFF, the Student Independent Film Festival in August 2007! Town superheroes Millard & Blake combat the evil Dinosaur and other evildoers to save Anytown, USA, from evil. This film showed at SIFF, the Student Independent Film Festival in August 2007! Jake Coan (Director, Millard, Editing); Missy Mattoon (Director, Blake); Madison Newbound (Director, Camera); Alexa Green (Director, Camera, Editing) Jake Coan (Director, Millard, Editing); Missy Mattoon (Director, Blake); Madison Newbound (Director, Camera); Alexa Green (Director, Camera, Editing) alexa batman battle cape dino dinosaur dragon fdp film festival fire fuzzy dice productions independent laser protect save siff spiderman student superhero superman world nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Closure - 2007 Apple Insomnia Film Festival Thu, 08 Nov 2007 13:34:07 -0800

Author: fdpfilms
Added: Thu, 08 Nov 2007 13:34:07 -0800
Duration: 576

If you like this, please rate this at the Apple website at http://edcommunity.apple.com/insomnia_fall07/item.php?itemID=841. 3 teens find solace in revisiting the abandoned campus of their closed-down high school. 2007 Apple Insomnia Film Festival entry. Sorry about the extra footage at the end, computer glitch. Required elements: Dutch Angle, Dream Sequence, Match Cut PLEASE VOTE!! THANK YOU!!

]]> 2007applebcdberkshirechangeclosedclosurecontestcountrydayfdpfdpfilmsfestivalfilmfuzzy dice productionshighinsomnialenoxmacmacbooknewproschoolshut downteenteenager http://revver.com/video/474229/closure-2007-apple-insomnia-film-festival/ http://revver.com/watch/474229 Closure - 2007 Apple Insomnia Film Festival If you like this, please rate this at the Apple website at http://edcommunity.apple.com/insomnia_fall07/item.php?itemID=841. 3 teens find solace in revisiting the abandoned campus of their closed-down high school. 2007 Apple Insomnia Film Festival entry. Sorry about the extra footage at the end, computer glitch. Required elements: Dutch Angle, Dream Sequence, Match Cut PLEASE VOTE!! THANK YOU!! If you like this, please rate this at the Apple website at http://edcommunity.apple.com/insomnia_fall07/item.php?itemID=841. 3 teens find solace in revisiting the abandoned campus of their closed-down high school. 2007 Apple Insomnia Film Festival entry. Sorry about the extra footage at the end, computer glitch. Required elements: Dutch Angle, Dream Sequence, Match Cut PLEASE VOTE!! THANK YOU!! Alexa Green (Director, Camera, Editing); Missy Mattoon (Director, Actress); Madison Newbound (Director, Actress); Charlotte Crane (Director, Actress); Sam Campoli (Actor); Andrew Campoli (Actor); Laurie Green (Actress); Ken Green (Actor); Music by Clemens Knieper; Special Thanks to Jesse Howard, Roberto Laurens, Ben Tobin, Tom Ciaburri, Jake Coan, Jae Choi Alexa Green (Director, Camera, Editing); Missy Mattoon (Director, Actress); Madison Newbound (Director, Actress); Charlotte Crane (Director, Actress); Sam Campoli (Actor); Andrew Campoli (Actor); Laurie Green (Actress); Ken Green (Actor); Music by Clemens Knieper; Special Thanks to Jesse Howard, Roberto Laurens, Ben Tobin, Tom Ciaburri, Jake Coan, Jae Choi 2007 apple bcd berkshire change closed closure contest country day fdp fdpfilms festival film fuzzy dice productions high insomnia lenox mac macbook new pro school shut down teen teenager nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Cinderella Story Wed, 07 Nov 2007 15:13:07 -0800

Author: fdpfilms
Added: Wed, 07 Nov 2007 15:13:07 -0800
Duration: 21

A clip of "Cinderella Story," done FDP-style.

]]> alexacinderellacinderella storycomedyevilfdpfdpfilmsfunnyfuzzy dice productionshilary duffhillary dufflizzie mcguiremovieparodyshortsistersstep mothertwins http://revver.com/video/472744/cinderella-story/ http://revver.com/watch/472744 Cinderella Story A clip of "Cinderella Story," done FDP-style. A clip of "Cinderella Story," done FDP-style. Alexa Green (Director, Actress, Camera, Editing) Alexa Green (Director, Actress, Camera, Editing) alexa cinderella cinderella story comedy evil fdp fdpfilms funny fuzzy dice productions hilary duff hillary duff lizzie mcguire movie parody short sisters step mother twins nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ News Station Wed, 07 Nov 2007 07:04:06 -0800

Author: fdpfilms
Added: Wed, 07 Nov 2007 07:04:06 -0800
Duration: 23

An experimental with picture-in-picture. Alexa scolds Jim for his ignorance. A real nail-biter!

]]> alexachastisecloudfdpfdpfilmsfightfuzzy dice productionsjimnewsrainscoldweather http://revver.com/video/471831/news-station/ http://revver.com/watch/471831 News Station An experimental with picture-in-picture. Alexa scolds Jim for his ignorance. A real nail-biter! An experimental with picture-in-picture. Alexa scolds Jim for his ignorance. A real nail-biter! Alexa Green (Director, Actress, Camera, Editing) Alexa Green (Director, Actress, Camera, Editing) alexa chastise cloud fdp fdpfilms fight fuzzy dice productions jim news rain scold weather nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Channel 3 Eyewitness News Wed, 07 Nov 2007 07:04:06 -0800

Author: fdpfilms
Added: Wed, 07 Nov 2007 07:04:06 -0800
Duration: 284

The Channel 3 team report the daily news.

]]> alexachicago cubscomedyfdpfdpfilmsfunnyfuzzy dice productionsgreen screenlicensenewsparodyred soxrescue heroessethshortsportsstationtoyweather http://revver.com/video/471835/channel-3-eyewitness-news/ http://revver.com/watch/471835 Channel 3 Eyewitness News The Channel 3 team report the daily news. The Channel 3 team report the daily news. Seth Reardon (Josh McSmoth, Josh McSmuth, Terrison O'Donnell), Alexa Green (Director, Camera, Editing, Wendy McSmith) Seth Reardon (Josh McSmoth, Josh McSmuth, Terrison O'Donnell), Alexa Green (Director, Camera, Editing, Wendy McSmith) alexa chicago cubs comedy fdp fdpfilms funny fuzzy dice productions green screen license news parody red sox rescue heroes seth short sports station toy weather nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ RAD & The Diamonds Tue, 06 Nov 2007 20:34:06 -0800

Author: fdpfilms
Added: Tue, 06 Nov 2007 20:34:06 -0800
Duration: 42

Alexa tries to coax RAD Robot to tell her where he hid the diamonds.

]]> burglarcomedydiamondfdpfdpfilmsfunnyfuzzy dice productionsjewelradrobotshortstone http://revver.com/video/471049/rad-the-diamonds/ http://revver.com/watch/471049 RAD & The Diamonds Alexa tries to coax RAD Robot to tell her where he hid the diamonds. Alexa tries to coax RAD Robot to tell her where he hid the diamonds. Alexa Green (Director, Actress, Camera, Editing) Alexa Green (Director, Actress, Camera, Editing) burglar comedy diamond fdp fdpfilms funny fuzzy dice productions jewel rad robot short stone nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ The Nutcracker Music Video Tue, 06 Nov 2007 17:13:06 -0800

Author: fdpfilms
Added: Tue, 06 Nov 2007 17:13:06 -0800
Duration: 175

Rachel dances to "Overture" from The Nutcracker.

]]> alexaballetdance music videodancingfdpfdpfilmsfuzzy dice productionsnutcrackeroverture http://revver.com/video/470945/the-nutcracker-music-video/ http://revver.com/watch/470945 The Nutcracker Music Video Rachel dances to "Overture" from The Nutcracker. Rachel dances to "Overture" from The Nutcracker. Rachel Gallagher (Dancer), Vicky Gallagher (Actress), Alexa Green (Director, Camera, Editing) Rachel Gallagher (Dancer), Vicky Gallagher (Actress), Alexa Green (Director, Camera, Editing) alexa ballet dance music video dancing fdp fdpfilms fuzzy dice productions nutcracker overture nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Furby Commercial Tue, 06 Nov 2007 16:55:10 -0800

Author: fdpfilms
Added: Tue, 06 Nov 2007 16:55:10 -0800
Duration: 54

Seth does an advertisement for Furby.

]]> cashcheckcomedycommercialcredit cardfdpfdpfilmsfunnyfurbyfuzzy dice productionsgunindependentindieinfomercialjokekillmoneyparodyshootshooting http://revver.com/video/470908/furby-commercial/ http://revver.com/watch/470908 Furby Commercial Seth does an advertisement for Furby. Seth does an advertisement for Furby. Seth Reardon (Actor), Alexa Green (Director, Camera, Editing) Seth Reardon (Actor), Alexa Green (Director, Camera, Editing) cash check comedy commercial credit card fdp fdpfilms funny furby fuzzy dice productions gun independent indie infomercial joke kill money parody shoot shooting nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Coca-Cola Commercial Tue, 06 Nov 2007 16:55:10 -0800

Author: fdpfilms
Added: Tue, 06 Nov 2007 16:55:10 -0800
Duration: 21

Seth does a short advertisement for Coca-Cola.

]]> adadvertisementcoca-colacokecomedycommercialfdpfunnyfuzzy dice productionspepsishortsoda http://revver.com/video/470935/coca-cola-commercial/ http://revver.com/watch/470935 Coca-Cola Commercial Seth does a short advertisement for Coca-Cola. Seth does a short advertisement for Coca-Cola. Seth Reardon (Actor), Alexa Green (Director, Camera, Editing) Seth Reardon (Actor), Alexa Green (Director, Camera, Editing) ad advertisement coca-cola coke comedy commercial fdp funny fuzzy dice productions pepsi short soda nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/