Videos by localvidsdotne Videos by localvidsdotne http://revver.com/u/localvidsdotne/ http://revver.com webmaster@revver.com Urban Gardener Thu, 16 Apr 2009 16:42:53 -0800

Author: localvidsdotne
Added: Thu, 16 Apr 2009 16:42:53 -0800
Duration: 0

Beautiful plants, including annuals, perennials, herbs, vegetables, tropical foliage and mums can transform a deck, patio or walkway into a beautiful living space! The Urban Gardener programs are designed to make it as Easy as 1-2-3!™ Jennifer Kurtz, of Hubie Grown LLC, invented and created the Urban Gardener Products and Programs so gardeners from coast to coast will have an easy, reliable way to increase the beauty of patios, decks and window boxes. The Urban Gardener allows everyone to garden! Small-space gardeners Busy homeowners Patio entertainers Outdoor decorators Children & First time Gardeners

]]> containerflowersgardenergardeningtomatoesurbanvegetables http://revver.com/video/1597702/urban-gardener/ http://revver.com/watch/1597702 Urban Gardener Beautiful plants, including annuals, perennials, herbs, vegetables, tropical foliage and mums can transform a deck, patio or walkway into a beautiful living space! The Urban Gardener programs are designed to make it as Easy as 1-2-3!™ Jennifer Kurtz, of Hubie Grown LLC, invented and created the Urban Gardener Products and Programs so gardeners from coast to coast will have an easy, reliable way to increase the beauty of patios, decks and window boxes. The Urban Gardener allows everyone to garden! Small-space gardeners Busy homeowners Patio entertainers Outdoor decorators Children & First time Gardeners Beautiful plants, including annuals, perennials, herbs, vegetables, tropical foliage and mums can transform a deck, patio or walkway into a beautiful living space! The Urban Gardener programs are designed to make it as Easy as 1-2-3!™ Jennifer Kurtz, of Hubie Grown LLC, invented and created the Urban Gardener Products and Programs so gardeners from coast to coast will have an easy, reliable way to increase the beauty of patios, decks and window boxes. The Urban Gardener allows everyone to garden! Small-space gardeners Busy homeowners Patio entertainers Outdoor decorators Children & First time Gardeners localvidsdotne localvidsdotne container flowers gardener gardening tomatoes urban vegetables nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ maximize IT investment and create solutions that drive results Thu, 09 Apr 2009 16:33:59 -0800

Author: localvidsdotne
Added: Thu, 09 Apr 2009 16:33:59 -0800
Duration: 0

Since 1991, ICI Systems has been helping customers around the world maximize their IT investment and create comprehensive solutions that drive business results.

]]> customeritserviceservicestechnology http://revver.com/video/1580829/maximize-it-investment-and-create-solutions-that-drive-results/ http://revver.com/watch/1580829 maximize IT investment and create solutions that drive results Since 1991, ICI Systems has been helping customers around the world maximize their IT investment and create comprehensive solutions that drive business results. Since 1991, ICI Systems has been helping customers around the world maximize their IT investment and create comprehensive solutions that drive business results. localvidsdotne localvidsdotne customer it service services technology nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Floor Coverings International Sun, 22 Mar 2009 01:50:15 -0800

Author: localvidsdotne
Added: Sun, 22 Mar 2009 01:50:15 -0800
Duration: 33

Call Floor Coverings International in Boise, Idaho at (208) 286-1194. At Floor Coverings International we lay inspiration and beauty at your feet. Let us help you reveal the beauty that lies in the perfect floor for you.

]]> areabambooboisecarpetcarpetingcoveringfloorflooringgaragehardwoodidlaminatelinoleumrugstiletilesvinylwood http://revver.com/video/1540587/floor-coverings-international/ http://revver.com/watch/1540587 Floor Coverings International Call Floor Coverings International in Boise, Idaho at (208) 286-1194. At Floor Coverings International we lay inspiration and beauty at your feet. Let us help you reveal the beauty that lies in the perfect floor for you. Call Floor Coverings International in Boise, Idaho at (208) 286-1194. At Floor Coverings International we lay inspiration and beauty at your feet. Let us help you reveal the beauty that lies in the perfect floor for you. localvidsdotne localvidsdotne area bamboo boise carpet carpeting covering floor flooring garage hardwood id laminate linoleum rugs tile tiles vinyl wood nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Floor Coverings International Fri, 13 Mar 2009 12:32:02 -0800

Author: localvidsdotne
Added: Fri, 13 Mar 2009 12:32:02 -0800
Duration: 33

Call Floor Coverings International in Wichita, Kansas at (316) 665-6782. At Floor Coverings International we lay inspiration and beauty at your feet. Let us help you reveal the beauty that lies in the perfect floor for you.

]]> areabamboocarpetcarpetingcoveringfloorflooringgaragehardwoodkslaminatelinoleumrugstiletilesvinylwichitawood http://revver.com/video/1533485/floor-coverings-international/ http://revver.com/watch/1533485 Floor Coverings International Call Floor Coverings International in Wichita, Kansas at (316) 665-6782. At Floor Coverings International we lay inspiration and beauty at your feet. Let us help you reveal the beauty that lies in the perfect floor for you. Call Floor Coverings International in Wichita, Kansas at (316) 665-6782. At Floor Coverings International we lay inspiration and beauty at your feet. Let us help you reveal the beauty that lies in the perfect floor for you. localvidsdotne localvidsdotne area bamboo carpet carpeting covering floor flooring garage hardwood ks laminate linoleum rugs tile tiles vinyl wichita wood nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ CertaPro Painters Wed, 11 Mar 2009 20:32:41 -0800

Author: localvidsdotne
Added: Wed, 11 Mar 2009 20:32:41 -0800
Duration: 60

Call CertaPro Painters at (212) 203-4130. Trust us for your interior & exterior house painting needs. Our services are reliable, safe, secure & professional. We have a 2 year warranty for our services.

]]> brooklyncertacertaprocostestimateexteriorfauxhomehouseinteriorkitchennypaintpainterpainterspaintingproresidentialstrippingwall http://revver.com/video/1528798/certapro-painters/ http://revver.com/watch/1528798 CertaPro Painters Call CertaPro Painters at (212) 203-4130. Trust us for your interior & exterior house painting needs. Our services are reliable, safe, secure & professional. We have a 2 year warranty for our services. Call CertaPro Painters at (212) 203-4130. Trust us for your interior & exterior house painting needs. Our services are reliable, safe, secure & professional. We have a 2 year warranty for our services. localvidsdotne localvidsdotne brooklyn certa certapro cost estimate exterior faux home house interior kitchen ny paint painter painters painting pro residential stripping wall nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Microbe Inotech Laboratories, Inc. Fri, 27 Feb 2009 20:33:30 -0800

Author: localvidsdotne
Added: Fri, 27 Feb 2009 20:33:30 -0800
Duration: 45

Call Microbe Inotech Laboratories, Inc. in SAINT LOUIS, MO at 314-266-7829. Microbe Inotech solves problems involving microbial detection, identification and enumeration.

]]> bacteriabiodegradationbiofeasibilitybioremediationbiotechnologycontractdetectionenumerationformulationidentificationlablaboratorieslaboratorylisteriamonitoringmycobacteriumpseudomonasresearchtestingtests http://revver.com/video/1512673/microbe-inotech-laboratories-inc/ http://revver.com/watch/1512673 Microbe Inotech Laboratories, Inc. Call Microbe Inotech Laboratories, Inc. in SAINT LOUIS, MO at 314-266-7829. Microbe Inotech solves problems involving microbial detection, identification and enumeration. Call Microbe Inotech Laboratories, Inc. in SAINT LOUIS, MO at 314-266-7829. Microbe Inotech solves problems involving microbial detection, identification and enumeration. localvidsdotne localvidsdotne bacteria biodegradation biofeasibility bioremediation biotechnology contract detection enumeration formulation identification lab laboratories laboratory listeria monitoring mycobacterium pseudomonas research testing tests nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Lords of London Limited Fri, 27 Feb 2009 20:33:30 -0800

Author: localvidsdotne
Added: Fri, 27 Feb 2009 20:33:30 -0800
Duration: 30

Call Lords of London Limited in NORTHPORT, NY at 888-509-5883. Get Cash within 24 hours from now! We are the refiner, not the middleman. We have over 65 years of experience. All employees are bonded so your gold is guarnteed safe

]]> 4cashforgoldgreenjewelrymoneyoldsellselling http://revver.com/video/1512702/lords-of-london-limited/ http://revver.com/watch/1512702 Lords of London Limited Call Lords of London Limited in NORTHPORT, NY at 888-509-5883. Get Cash within 24 hours from now! We are the refiner, not the middleman. We have over 65 years of experience. All employees are bonded so your gold is guarnteed safe Call Lords of London Limited in NORTHPORT, NY at 888-509-5883. Get Cash within 24 hours from now! We are the refiner, not the middleman. We have over 65 years of experience. All employees are bonded so your gold is guarnteed safe localvidsdotne localvidsdotne 4 cash for gold green jewelry money old sell selling nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Kiddie Academy of Batavia Mon, 23 Feb 2009 23:52:46 -0800

Author: localvidsdotne
Added: Mon, 23 Feb 2009 23:52:46 -0800
Duration: 30

"Call Kiddie Academy of Batavia at (630) 457-1702. Serving families and their children ages 6 weeks to 12 years old, offering full time care, before- and after-school care and summer camp programs."

]]> affordablebabybestcarecentercertifiedchildchildcaredaydaycareeducationfindlicensedlocalnurserypreschoolprogramproviderratesservicesteacher http://revver.com/video/1505581/kiddie-academy-of-batavia/ http://revver.com/watch/1505581 Kiddie Academy of Batavia "Call Kiddie Academy of Batavia at (630) 457-1702. Serving families and their children ages 6 weeks to 12 years old, offering full time care, before- and after-school care and summer camp programs." "Call Kiddie Academy of Batavia at (630) 457-1702. Serving families and their children ages 6 weeks to 12 years old, offering full time care, before- and after-school care and summer camp programs." localvidsdotne localvidsdotne affordable baby best care center certified child childcare day daycare education find licensed local nursery preschool program provider rates services teacher nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Kiddie Academy of Bloomfield Mon, 23 Feb 2009 23:52:46 -0800

Author: localvidsdotne
Added: Mon, 23 Feb 2009 23:52:46 -0800
Duration: 30

"Call Kiddie Academy of Bloomfield at (860) 967-0850. Serving families and their children ages 6 weeks to 12 years old, offering full time care, before- and after-school care and summer camp programs."

]]> affordablebabybestcarecentercertifiedchildchildcaredaydaycareeducationfindlicensedlocalnurserypreschoolprogramproviderratesservicesteacher http://revver.com/video/1505596/kiddie-academy-of-bloomfield/ http://revver.com/watch/1505596 Kiddie Academy of Bloomfield "Call Kiddie Academy of Bloomfield at (860) 967-0850. Serving families and their children ages 6 weeks to 12 years old, offering full time care, before- and after-school care and summer camp programs." "Call Kiddie Academy of Bloomfield at (860) 967-0850. Serving families and their children ages 6 weeks to 12 years old, offering full time care, before- and after-school care and summer camp programs." localvidsdotne localvidsdotne affordable baby best care center certified child childcare day daycare education find licensed local nursery preschool program provider rates services teacher nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Kiddie Academy of Bradenton Mon, 23 Feb 2009 23:52:46 -0800

Author: localvidsdotne
Added: Mon, 23 Feb 2009 23:52:46 -0800
Duration: 30

"Call Kiddie Academy of Bradenton at (941) 306-1014. Serving families and their children ages 6 weeks to 12 years old, offering full time care, before- and after-school care and summer camp programs."

]]> affordablebabybestcarecentercertifiedchildchildcaredaydaycareeducationfindlicensedlocalnurserypreschoolprogramproviderratesservicesteacher http://revver.com/video/1505601/kiddie-academy-of-bradenton/ http://revver.com/watch/1505601 Kiddie Academy of Bradenton "Call Kiddie Academy of Bradenton at (941) 306-1014. Serving families and their children ages 6 weeks to 12 years old, offering full time care, before- and after-school care and summer camp programs." "Call Kiddie Academy of Bradenton at (941) 306-1014. Serving families and their children ages 6 weeks to 12 years old, offering full time care, before- and after-school care and summer camp programs." localvidsdotne localvidsdotne affordable baby best care center certified child childcare day daycare education find licensed local nursery preschool program provider rates services teacher nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ CertaPro Painters Sun, 22 Feb 2009 01:59:24 -0800

Author: localvidsdotne
Added: Sun, 22 Feb 2009 01:59:24 -0800
Duration: 60

Call CertaPro Painters at (919) 439-8063. Trust us for your interior & exterior house painting needs. Our services are reliable, safe, secure & professional. We have a 2 year warranty for our services.

]]> certacertaprocostdurhamestimateexteriorfauxhomehouseinteriorkitchenncpaintpainterpainterspaintingproresidentialstrippingwall http://revver.com/video/1501959/certapro-painters/ http://revver.com/watch/1501959 CertaPro Painters Call CertaPro Painters at (919) 439-8063. Trust us for your interior & exterior house painting needs. Our services are reliable, safe, secure & professional. We have a 2 year warranty for our services. Call CertaPro Painters at (919) 439-8063. Trust us for your interior & exterior house painting needs. Our services are reliable, safe, secure & professional. We have a 2 year warranty for our services. localvidsdotne localvidsdotne certa certapro cost durham estimate exterior faux home house interior kitchen nc paint painter painters painting pro residential stripping wall nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ CertaPro Painters Sat, 21 Feb 2009 01:52:39 -0800

Author: localvidsdotne
Added: Sat, 21 Feb 2009 01:52:39 -0800
Duration: 60

Call CertaPro Painters at (914) 752-5471. Trust us for your interior & exterior house painting needs. Our services are reliable, safe, secure & professional. We have a 2 year warranty for our services.

]]> certacertaprocostestimateexteriorfauxhomehouseinteriorjeffersonkitchennypaintpainterpainterspaintingproresidentialstrippingvalleywall http://revver.com/video/1501940/certapro-painters/ http://revver.com/watch/1501940 CertaPro Painters Call CertaPro Painters at (914) 752-5471. Trust us for your interior & exterior house painting needs. Our services are reliable, safe, secure & professional. We have a 2 year warranty for our services. Call CertaPro Painters at (914) 752-5471. Trust us for your interior & exterior house painting needs. Our services are reliable, safe, secure & professional. We have a 2 year warranty for our services. localvidsdotne localvidsdotne certa certapro cost estimate exterior faux home house interior jefferson kitchen ny paint painter painters painting pro residential stripping valley wall nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Debt Resources of America Wed, 11 Feb 2009 22:52:40 -0800

Author: localvidsdotne
Added: Wed, 11 Feb 2009 22:52:40 -0800
Duration: 37

Call Debt Resources of America in Frisco TX at (214) 306-7205. We are a collection of trained and experienced professionals who work with our clients to set up a customizable plan to eliminate their debt in 18 to 36 months

]]> adviceassistancedebteliminateeliminationemergencygethelpimmediatelowernegotiationofreducereductionreliefridsettlesettlementunsecuredwith http://revver.com/video/1487685/debt-resources-of-america/ http://revver.com/watch/1487685 Debt Resources of America Call Debt Resources of America in Frisco TX at (214) 306-7205. We are a collection of trained and experienced professionals who work with our clients to set up a customizable plan to eliminate their debt in 18 to 36 months Call Debt Resources of America in Frisco TX at (214) 306-7205. We are a collection of trained and experienced professionals who work with our clients to set up a customizable plan to eliminate their debt in 18 to 36 months localvidsdotne localvidsdotne advice assistance debt eliminate elimination emergency get help immediate lower negotiation of reduce reduction relief rid settle settlement unsecured with nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ MBA Tue, 10 Feb 2009 20:33:37 -0800

Author: localvidsdotne
Added: Tue, 10 Feb 2009 20:33:37 -0800
Duration: 40

Call MBA in CHANTILLY, VA at 1-866-541-8771. Military Benefit Association (MBA) is a non-profit organization of active and non active military personnel offering group life insurance and other benefits.

]]> activearmybenefitbenefitsdisabilitydisableddutyforhealthinsurancelifemedicalmilitaryosglisglisglvtermtricarevaveteranveteransvgli http://revver.com/video/1486048/mba/ http://revver.com/watch/1486048 MBA Call MBA in CHANTILLY, VA at 1-866-541-8771. Military Benefit Association (MBA) is a non-profit organization of active and non active military personnel offering group life insurance and other benefits. Call MBA in CHANTILLY, VA at 1-866-541-8771. Military Benefit Association (MBA) is a non-profit organization of active and non active military personnel offering group life insurance and other benefits. localvidsdotne localvidsdotne active army benefit benefits disability disabled duty for health insurance life medical military osgli sgli sglv term tricare va veteran veterans vgli nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ UHS Insurance Agency Thu, 15 Jan 2009 01:52:39 -0800

Author: localvidsdotne
Added: Thu, 15 Jan 2009 01:52:39 -0800
Duration: 60

Call UHS Insurance Agency at 866-558-0294. UHS' personal lines specialists offer comprehensive services to protect the current and evolving needs of individuals and their families.

]]> apartmentcompaniescondocondominiumhomehomeownerhomeownershomeshouseinsurancelandlordownerownerspropertyquotequotesrateratesrenters http://revver.com/video/1439769/uhs-insurance-agency/ http://revver.com/watch/1439769 UHS Insurance Agency Call UHS Insurance Agency at 866-558-0294. UHS' personal lines specialists offer comprehensive services to protect the current and evolving needs of individuals and their families. Call UHS Insurance Agency at 866-558-0294. UHS' personal lines specialists offer comprehensive services to protect the current and evolving needs of individuals and their families. localvidsdotne localvidsdotne apartment companies condo condominium home homeowner homeowners homes house insurance landlord owner owners property quote quotes rate rates renters nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ The Knife Merchant Wed, 07 Jan 2009 16:33:22 -0800

Author: localvidsdotne
Added: Wed, 07 Jan 2009 16:33:22 -0800
Duration: 30

Call The Knife Merchant at (800) 714-8226. We are professional chefs who have entered this business because we love knives. Our cutlery and cookware meet the highest standards set by serious cooks and chefs.

]]> cookingcookwarecutleryjapanesekitchenknifeknifesknivesnonnon-sticksetsetssticksushivegetable http://revver.com/video/1424259/the-knife-merchant/ http://revver.com/watch/1424259 The Knife Merchant Call The Knife Merchant at (800) 714-8226. We are professional chefs who have entered this business because we love knives. Our cutlery and cookware meet the highest standards set by serious cooks and chefs. Call The Knife Merchant at (800) 714-8226. We are professional chefs who have entered this business because we love knives. Our cutlery and cookware meet the highest standards set by serious cooks and chefs. localvidsdotne localvidsdotne cooking cookware cutlery japanese kitchen knife knifes knives non non-stick set sets stick sushi vegetable nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Scratch DJ Academy LLC Sat, 20 Dec 2008 01:31:39 -0800

Author: localvidsdotne
Added: Sat, 20 Dec 2008 01:31:39 -0800
Duration: 45

Call Scratch DJ Academy LLC at (866) 920-3991. Scratch Events was created in 2002 as a consolidated resource for anyone looking to hire professional club DJs for private and corporate events.

]]> agencybookbookingcompanycorporatecostdiscdjdjsestimateeventfeeshirejockeyjockeyspackagesprivateservicewedding http://revver.com/video/1392145/scratch-dj-academy-llc/ http://revver.com/watch/1392145 Scratch DJ Academy LLC Call Scratch DJ Academy LLC at (866) 920-3991. Scratch Events was created in 2002 as a consolidated resource for anyone looking to hire professional club DJs for private and corporate events. Call Scratch DJ Academy LLC at (866) 920-3991. Scratch Events was created in 2002 as a consolidated resource for anyone looking to hire professional club DJs for private and corporate events. localvidsdotne localvidsdotne agency book booking company corporate cost disc dj djs estimate event fees hire jockey jockeys packages private service wedding nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ My Exquisite Foods Sat, 20 Dec 2008 01:31:39 -0800

Author: localvidsdotne
Added: Sat, 20 Dec 2008 01:31:39 -0800
Duration: 34

Call MyExquisiteFoods.com at 786-871-7933. Online solution for all of your gourmet cravings. Whether it be fresh caviar or our sought after fois gras, we deliver the highest caliber groumet foods which are sure to satisfy.

]]> anchoviesbuycaviarcavierchanterellescheesechocolateescargotfoodsfruitsgourmetmeatsmushroomsnutspateprosciuttosalmonseafoodteatrufflesvinegar http://revver.com/video/1392028/my-exquisite-foods/ http://revver.com/watch/1392028 My Exquisite Foods Call MyExquisiteFoods.com at 786-871-7933. Online solution for all of your gourmet cravings. Whether it be fresh caviar or our sought after fois gras, we deliver the highest caliber groumet foods which are sure to satisfy. Call MyExquisiteFoods.com at 786-871-7933. Online solution for all of your gourmet cravings. Whether it be fresh caviar or our sought after fois gras, we deliver the highest caliber groumet foods which are sure to satisfy. localvidsdotne localvidsdotne anchovies buy caviar cavier chanterelles cheese chocolate escargot foods fruits gourmet meats mushrooms nuts pate prosciutto salmon seafood tea truffles vinegar nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Aces Credit Solutions Wed, 17 Dec 2008 19:49:38 -0800

Author: localvidsdotne
Added: Wed, 17 Dec 2008 19:49:38 -0800
Duration: 48

Call Aces Credit Solutions in SAINT CHARLES, IL at (866) 481-1109. Behind in your payments and and struggling to make ends meet or possibly facing foreclosure? We are committed to providing you the best financial solution!

]]> coachingcompaniescompanyconsultantcreditdebtexpertfinancinglendingmortgagereliefresolutionservicessolutionsspecialist http://revver.com/video/1387423/aces-credit-solutions/ http://revver.com/watch/1387423 Aces Credit Solutions Call Aces Credit Solutions in SAINT CHARLES, IL at (866) 481-1109. Behind in your payments and and struggling to make ends meet or possibly facing foreclosure? We are committed to providing you the best financial solution! Call Aces Credit Solutions in SAINT CHARLES, IL at (866) 481-1109. Behind in your payments and and struggling to make ends meet or possibly facing foreclosure? We are committed to providing you the best financial solution! localvidsdotne localvidsdotne coaching companies company consultant credit debt expert financing lending mortgage relief resolution services solutions specialist nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ HealthPlanZoom.com Wed, 19 Nov 2008 22:52:35 -0800

Author: localvidsdotne
Added: Wed, 19 Nov 2008 22:52:35 -0800
Duration: 50

Call HealthPlanZoom.com in San Diego 619-677-1439. Providing Individual and Family Life, Health and Long Term Care Insurance, Disability Income Protection, Medicare Supplement Plans and more.

]]> 401kaccidentcadentaldiegodisabilitygrouphealthindividualinsuranceiralifeplanpoliciessanseptermtravelumbrellauniversalvision http://revver.com/video/1328977/healthplanzoomcom/ http://revver.com/watch/1328977 HealthPlanZoom.com Call HealthPlanZoom.com in San Diego 619-677-1439. Providing Individual and Family Life, Health and Long Term Care Insurance, Disability Income Protection, Medicare Supplement Plans and more. Call HealthPlanZoom.com in San Diego 619-677-1439. Providing Individual and Family Life, Health and Long Term Care Insurance, Disability Income Protection, Medicare Supplement Plans and more. localvidsdotne localvidsdotne 401k accident ca dental diego disability group health individual insurance ira life plan policies san sep term travel umbrella universal vision nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Premier Watch Repairs Tue, 18 Nov 2008 22:52:36 -0800

Author: localvidsdotne
Added: Tue, 18 Nov 2008 22:52:36 -0800
Duration: 45

Call Premier Watch Repairs at 808-120-2801. Premier Watch Repairs has been specialising in the repair of quality Swiss, Japanese and Russian watches from its Bristol based workshop since 2002.

]]> braceletbristolbuycleaningcollectiondesignerfashionfixfreeheuermaintenanceonlinepartsrepairreplacementreturnsecureservicingsportsstoretagwatchwatcheswatchmakeryate http://revver.com/video/1327043/premier-watch-repairs/ http://revver.com/watch/1327043 Premier Watch Repairs Call Premier Watch Repairs at 808-120-2801. Premier Watch Repairs has been specialising in the repair of quality Swiss, Japanese and Russian watches from its Bristol based workshop since 2002. Call Premier Watch Repairs at 808-120-2801. Premier Watch Repairs has been specialising in the repair of quality Swiss, Japanese and Russian watches from its Bristol based workshop since 2002. localvidsdotne localvidsdotne bracelet bristol buy cleaning collection designer fashion fix free heuer maintenance online parts repair replacement return secure servicing sports store tag watch watches watchmaker yate nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Evanescence MedSpa Tue, 18 Nov 2008 16:33:24 -0800

Author: localvidsdotne
Added: Tue, 18 Nov 2008 16:33:24 -0800
Duration: 31

Call Evanescence MedSpa in BURBANK, CA at (818) 641-1875. We're here to offer some of the best in medical and cosmetic aesthetics including laser hair removal, laser vein removal, skin tightening, botox, Juvederm, and more.

]]> antiagingcandelacosmeticcrystaldermatologyexfoliationfacialfacialsgentlehairkineraselasermedicalmedspamicrodermabrasionregenerationrejuvenationremovalresurfacingskinspatherapytighteningtonetreatmentunevenveinwrinkleyag http://revver.com/video/1326487/evanescence-medspa/ http://revver.com/watch/1326487 Evanescence MedSpa Call Evanescence MedSpa in BURBANK, CA at (818) 641-1875. We're here to offer some of the best in medical and cosmetic aesthetics including laser hair removal, laser vein removal, skin tightening, botox, Juvederm, and more. Call Evanescence MedSpa in BURBANK, CA at (818) 641-1875. We're here to offer some of the best in medical and cosmetic aesthetics including laser hair removal, laser vein removal, skin tightening, botox, Juvederm, and more. localvidsdotne localvidsdotne antiaging candela cosmetic crystal dermatology exfoliation facial facials gentle hair kinerase laser medical medspa microdermabrasion regeneration rejuvenation removal resurfacing skin spa therapy tightening tone treatment uneven vein wrinkle yag nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ QuoteMeGreg.com Wed, 12 Nov 2008 20:39:40 -0800

Author: localvidsdotne
Added: Wed, 12 Nov 2008 20:39:40 -0800
Duration: 38

Call QuoteMeGreg.com at (678) 701-9158. We believe that term life insurance is one of the key building blocks to good financial planning.

]]> annuitiesannuityanuitycomparecostdeferredfamilyfixedfreeguaranteedinsurancelifelowmetlifeplanspolicyquotequotesratesterm http://revver.com/video/1313237/quotemegregcom/ http://revver.com/watch/1313237 QuoteMeGreg.com Call QuoteMeGreg.com at (678) 701-9158. We believe that term life insurance is one of the key building blocks to good financial planning. Call QuoteMeGreg.com at (678) 701-9158. We believe that term life insurance is one of the key building blocks to good financial planning. localvidsdotne localvidsdotne annuities annuity anuity compare cost deferred family fixed free guaranteed insurance life low metlife plans policy quote quotes rates term nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Argent Court Tue, 11 Nov 2008 19:01:11 -0800

Author: localvidsdotne
Added: Tue, 11 Nov 2008 19:01:11 -0800
Duration: 119

Call Argent Court in San Antonio, TX at (888) 309-5019. New retirement alternative for seniors combining independent living with personal care in a warm, dignified community setting. Give Us a Call Today.

]]> antonioassistedcentercitizencommunityfolksgrouphomehouselivingoldpeopleretirementsanseniorsupporttx http://revver.com/video/1311902/argent-court/ http://revver.com/watch/1311902 Argent Court Call Argent Court in San Antonio, TX at (888) 309-5019. New retirement alternative for seniors combining independent living with personal care in a warm, dignified community setting. Give Us a Call Today. Call Argent Court in San Antonio, TX at (888) 309-5019. New retirement alternative for seniors combining independent living with personal care in a warm, dignified community setting. Give Us a Call Today. localvidsdotne localvidsdotne antonio assisted center citizen community folks group home house living old people retirement san senior support tx nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Powercell1 Tue, 11 Nov 2008 19:01:11 -0800

Author: localvidsdotne
Added: Tue, 11 Nov 2008 19:01:11 -0800
Duration: 33

Call Powercell1 in MARION, NC, MA 828-527-0167 Powercell1.com is a site dedicated to helping people crossover to a work from home lifestyle. We can assist anyone in starting a web-based business.

]]> basedbusinessfromhomehomebasedideasinternetlinemakemakingmoneynetononlineopportunitiesstartthetowayswebworkyour http://revver.com/video/1311916/powercell1/ http://revver.com/watch/1311916 Powercell1 Call Powercell1 in MARION, NC, MA 828-527-0167 Powercell1.com is a site dedicated to helping people crossover to a work from home lifestyle. We can assist anyone in starting a web-based business. Call Powercell1 in MARION, NC, MA 828-527-0167 Powercell1.com is a site dedicated to helping people crossover to a work from home lifestyle. We can assist anyone in starting a web-based business. localvidsdotne localvidsdotne based business from home homebased ideas internet line make making money net on online opportunities start the to ways web work your nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Servis and Taylor Thu, 06 Nov 2008 22:51:46 -0800

Author: localvidsdotne
Added: Thu, 06 Nov 2008 22:51:46 -0800
Duration: 55

Call Servis and Taylor in Los Angeles, CA at (310) 584-7708. Servis and Taylor are a custom jeweler located on the westside of Los Angeles. We feature jewelry from today's finest designers. Come see us today!

]]> beardesignerdiamonddiamondsengagementjewelerpolarringswedding http://revver.com/video/1303849/servis-and-taylor/ http://revver.com/watch/1303849 Servis and Taylor Call Servis and Taylor in Los Angeles, CA at (310) 584-7708. Servis and Taylor are a custom jeweler located on the westside of Los Angeles. We feature jewelry from today's finest designers. Come see us today! Call Servis and Taylor in Los Angeles, CA at (310) 584-7708. Servis and Taylor are a custom jeweler located on the westside of Los Angeles. We feature jewelry from today's finest designers. Come see us today! localvidsdotne localvidsdotne bear designer diamond diamonds engagement jeweler polar rings wedding nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Cardinal Luxury Residences Thu, 06 Nov 2008 16:35:30 -0800

Author: localvidsdotne
Added: Thu, 06 Nov 2008 16:35:30 -0800
Duration: 81

Call Cardinal Luxury Residence in New York at (888) 685-6377. Indulge in New York’s finest when you are a guest at M127 Residences. The luxurious alternative to a hotel for your next visit to New York City.

]]> alternativeapartmentapartmentsboutiquebusinessforfurnishedhotelhotelshousingleaselodgingluxurynewnyrentrentingsuitetoyork http://revver.com/video/1303463/cardinal-luxury-residences/ http://revver.com/watch/1303463 Cardinal Luxury Residences Call Cardinal Luxury Residence in New York at (888) 685-6377. Indulge in New York’s finest when you are a guest at M127 Residences. The luxurious alternative to a hotel for your next visit to New York City. Call Cardinal Luxury Residence in New York at (888) 685-6377. Indulge in New York’s finest when you are a guest at M127 Residences. The luxurious alternative to a hotel for your next visit to New York City. localvidsdotne localvidsdotne alternative apartment apartments boutique business for furnished hotel hotels housing lease lodging luxury new ny rent renting suite to york nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Gorsegner Brothers Fri, 31 Oct 2008 20:36:32 -0800

Author: localvidsdotne
Added: Fri, 31 Oct 2008 20:36:32 -0800
Duration: 42

Call Gorsegner Brothers in Atlantic Highlands, NJ at (732) 391-4505.We offer our clients the best in quality products, service, and support. Let us be your source for hardwood flooring. Come visit us today!

]]> finishfloorflooringfloorshardwoodinstallinstallationinstallinglaminaterefinishrefinishingrepairwoodwooden http://revver.com/video/1291655/gorsegner-brothers/ http://revver.com/watch/1291655 Gorsegner Brothers Call Gorsegner Brothers in Atlantic Highlands, NJ at (732) 391-4505.We offer our clients the best in quality products, service, and support. Let us be your source for hardwood flooring. Come visit us today! Call Gorsegner Brothers in Atlantic Highlands, NJ at (732) 391-4505.We offer our clients the best in quality products, service, and support. Let us be your source for hardwood flooring. Come visit us today! localvidsdotne localvidsdotne finish floor flooring floors hardwood install installation installing laminate refinish refinishing repair wood wooden nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Premier Watch Repairs Fri, 31 Oct 2008 20:36:32 -0800

Author: localvidsdotne
Added: Fri, 31 Oct 2008 20:36:32 -0800
Duration: 45

Call Premier Watch Repairs at 808-120-2801. Premier Watch Repairs has been specializing in the repair of quality Swiss, Japanese and Russian watches from its Bristol based workshop since 2002.

]]> braceletbristolbuycleaningcollectiondesignerfashionfixfreeheuermaintenanceonlinepartsrepairreplacementreturnsecureservicingsportsstoretagwatchwatcheswatchmakeryate http://revver.com/video/1291664/premier-watch-repairs/ http://revver.com/watch/1291664 Premier Watch Repairs Call Premier Watch Repairs at 808-120-2801. Premier Watch Repairs has been specializing in the repair of quality Swiss, Japanese and Russian watches from its Bristol based workshop since 2002. Call Premier Watch Repairs at 808-120-2801. Premier Watch Repairs has been specializing in the repair of quality Swiss, Japanese and Russian watches from its Bristol based workshop since 2002. localvidsdotne localvidsdotne bracelet bristol buy cleaning collection designer fashion fix free heuer maintenance online parts repair replacement return secure servicing sports store tag watch watches watchmaker yate nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Pet Stop of the Spacecoast Tue, 28 Oct 2008 22:34:26 -0800

Author: localvidsdotne
Added: Tue, 28 Oct 2008 22:34:26 -0800
Duration: 40

Call Pet Stop of the Spacecoast in Melbourne at 321-684-4907 We give you the best, most customizable pet containment system on the market today. Products are designed, installed & tuned to make your dog’s life happy & safe.

]]> animalbatteriesbatterybrandscarecollarcontainmentcustomizabledogelectronicfencefencesfencingflgroomingindoorinstallationmelbourneoutdoorpetplansqualifiedreplacementsalesserviceservicesservicingtrainingtransmitters http://revver.com/video/1285602/pet-stop-of-the-spacecoast/ http://revver.com/watch/1285602 Pet Stop of the Spacecoast Call Pet Stop of the Spacecoast in Melbourne at 321-684-4907 We give you the best, most customizable pet containment system on the market today. Products are designed, installed & tuned to make your dog’s life happy & safe. Call Pet Stop of the Spacecoast in Melbourne at 321-684-4907 We give you the best, most customizable pet containment system on the market today. Products are designed, installed & tuned to make your dog’s life happy & safe. localvidsdotne localvidsdotne animal batteries battery brands care collar containment customizable dog electronic fence fences fencing fl grooming indoor installation melbourne outdoor pet plans qualified replacement sales service services servicing training transmitters nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Handyman San Antonio Tue, 28 Oct 2008 19:55:18 -0800

Author: localvidsdotne
Added: Tue, 28 Oct 2008 19:55:18 -0800
Duration: 39

Call Handyman Connection in San Antonio, TX at 210-764-6937. From small home repairs to improvements, you can trust the Professionals at Handyman Connection of Spokane, WA. Home improvements done right. Done quick. Guaranteed.

]]> contractorhandyhandymanhomeimprovementlicensedmanplumbingremodelingrenovationrepairservicework http://revver.com/video/1285038/handyman-san-antonio/ http://revver.com/watch/1285038 Handyman San Antonio Call Handyman Connection in San Antonio, TX at 210-764-6937. From small home repairs to improvements, you can trust the Professionals at Handyman Connection of Spokane, WA. Home improvements done right. Done quick. Guaranteed. Call Handyman Connection in San Antonio, TX at 210-764-6937. From small home repairs to improvements, you can trust the Professionals at Handyman Connection of Spokane, WA. Home improvements done right. Done quick. Guaranteed. localvidsdotne localvidsdotne contractor handy handyman home improvement licensed man plumbing remodeling renovation repair service work nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ HealthPlanZoom.com Fri, 24 Oct 2008 23:54:47 -0800

Author: localvidsdotne
Added: Fri, 24 Oct 2008 23:54:47 -0800
Duration: 50

Call HealthPlanZoom.com in San Diego 619-677-1439. Providing Individual and Family Life, Health and Long Term Care Insurance, Disability Income Protection, Medicare Supplement Plans and more.

]]> 401kaccidentcadentaldiegodisabilitygrouphealthindividualinsuranceiralifeplanpoliciessanseptermtravelumbrellauniversalvision http://revver.com/video/1277594/healthplanzoomcom/ http://revver.com/watch/1277594 HealthPlanZoom.com Call HealthPlanZoom.com in San Diego 619-677-1439. Providing Individual and Family Life, Health and Long Term Care Insurance, Disability Income Protection, Medicare Supplement Plans and more. Call HealthPlanZoom.com in San Diego 619-677-1439. Providing Individual and Family Life, Health and Long Term Care Insurance, Disability Income Protection, Medicare Supplement Plans and more. localvidsdotne localvidsdotne 401k accident ca dental diego disability group health individual insurance ira life plan policies san sep term travel umbrella universal vision nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ T & L Heating Thu, 23 Oct 2008 21:54:44 -0800

Author: localvidsdotne
Added: Thu, 23 Oct 2008 21:54:44 -0800
Duration: 29

Call T & L Heating in Reno, NV at (775)473-8973. With 35 years of experience in professional household central air and heating systems, we offer competitive prices, expert installation and quality customer care. Call Us Today.

]]> acairandcentralconditionerconditioningcoolinggasheatheatinghomenvrenosystemunit http://revver.com/video/1275331/t-l-heating/ http://revver.com/watch/1275331 T & L Heating Call T & L Heating in Reno, NV at (775)473-8973. With 35 years of experience in professional household central air and heating systems, we offer competitive prices, expert installation and quality customer care. Call Us Today. Call T & L Heating in Reno, NV at (775)473-8973. With 35 years of experience in professional household central air and heating systems, we offer competitive prices, expert installation and quality customer care. Call Us Today. localvidsdotne localvidsdotne ac air and central conditioner conditioning cooling gas heat heating home nv reno system unit nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ CarandCycleClub.com Thu, 23 Oct 2008 17:54:45 -0800

Author: localvidsdotne
Added: Thu, 23 Oct 2008 17:54:45 -0800
Duration: 36

Call CarandCycleClub.com, Yorktown Heights, New York at (914) 873-4968. Our website brings those who have a passion for car and motorcycles together through Blogs, Chat, Custom Personal Page, etc… Be a part of our community!

]]> advertisingautomobilesautoscarcarscyclesitespacespaceswebsite http://revver.com/video/1274996/carandcycleclubcom/ http://revver.com/watch/1274996 CarandCycleClub.com Call CarandCycleClub.com, Yorktown Heights, New York at (914) 873-4968. Our website brings those who have a passion for car and motorcycles together through Blogs, Chat, Custom Personal Page, etc… Be a part of our community! Call CarandCycleClub.com, Yorktown Heights, New York at (914) 873-4968. Our website brings those who have a passion for car and motorcycles together through Blogs, Chat, Custom Personal Page, etc… Be a part of our community! localvidsdotne localvidsdotne advertising automobiles autos car cars cycle site space spaces website nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Pet Stop of the Spacecoast Mon, 20 Oct 2008 16:33:39 -0800

Author: localvidsdotne
Added: Mon, 20 Oct 2008 16:33:39 -0800
Duration: 40

Include short, descriptive, keyword-loaded copy that begins with your domain and includes a call to action or offer that a user will read and want to visit your web site. You may wish to include your phone number. 200 characters or less is the ideal length that ensures your submission will reach the maximum number of sites. Longer text is ok but may cause failed submissions for some sites.

]]> animalbatteriesbatterybrandscarecollarcontainmentcustomizabledogelectronicfencefencesfencingflgroomingindoorinstallationmelbourneoutdoorpetplansqualifiedreplacementsalesserviceservicesservicingtrainingtransmitters http://revver.com/video/1263464/pet-stop-of-the-spacecoast/ http://revver.com/watch/1263464 Pet Stop of the Spacecoast Include short, descriptive, keyword-loaded copy that begins with your domain and includes a call to action or offer that a user will read and want to visit your web site. You may wish to include your phone number. 200 characters or less is the ideal length that ensures your submission will reach the maximum number of sites. Longer text is ok but may cause failed submissions for some sites. Include short, descriptive, keyword-loaded copy that begins with your domain and includes a call to action or offer that a user will read and want to visit your web site. You may wish to include your phone number. 200 characters or less is the ideal length that ensures your submission will reach the maximum number of sites. Longer text is ok but may cause failed submissions for some sites. localvidsdotne localvidsdotne animal batteries battery brands care collar containment customizable dog electronic fence fences fencing fl grooming indoor installation melbourne outdoor pet plans qualified replacement sales service services servicing training transmitters nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ National Waterproofing Systems Thu, 16 Oct 2008 17:54:04 -0800

Author: localvidsdotne
Added: Thu, 16 Oct 2008 17:54:04 -0800
Duration: 98

Call National Waterproofing Systems in Huntington Station, NY at 631-479-2152. Family Owned and Operated, Advanced Basement Waterproofing & Mold Removal. Serving the 5 boroughs of New York, Nassau and Suffolk County Long Island

]]> basementbasementscementconcretecontroldrainagefloodfoundationhousehuntingtonmaterialmoldnationalnypermanentpermanentwaterproofing.comproductsproofproofingremediationremovalstationsystemswaterwater-proofingwaterproofwaterproofingwood http://revver.com/video/1252070/national-waterproofing-systems/ http://revver.com/watch/1252070 National Waterproofing Systems Call National Waterproofing Systems in Huntington Station, NY at 631-479-2152. Family Owned and Operated, Advanced Basement Waterproofing & Mold Removal. Serving the 5 boroughs of New York, Nassau and Suffolk County Long Island Call National Waterproofing Systems in Huntington Station, NY at 631-479-2152. Family Owned and Operated, Advanced Basement Waterproofing & Mold Removal. Serving the 5 boroughs of New York, Nassau and Suffolk County Long Island localvidsdotne localvidsdotne basement basements cement concrete control drainage flood foundation house huntington material mold national ny permanent permanentwaterproofing.com products proof proofing remediation removal station systems water water-proofing waterproof waterproofing wood nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ The Bag Movement Wed, 15 Oct 2008 16:34:46 -0800

Author: localvidsdotne
Added: Wed, 15 Oct 2008 16:34:46 -0800
Duration: 46

Call The Bag Movement at (877) 448-3590. At The Bag Movement, we are committed in making a difference in both our environment and the causes we support. We sell reusable shopping bags which 15% of the proceeds go to charities.

]]> bagbagscharitablecharitydonationsecoecobagsenvironmentenvironmentallyfriendlygreengrocerymeshmovementmultipacknonnon-wovennonwovenpolyesterreusableshoppingthewholesalewoven http://revver.com/video/1247641/the-bag-movement/ http://revver.com/watch/1247641 The Bag Movement Call The Bag Movement at (877) 448-3590. At The Bag Movement, we are committed in making a difference in both our environment and the causes we support. We sell reusable shopping bags which 15% of the proceeds go to charities. Call The Bag Movement at (877) 448-3590. At The Bag Movement, we are committed in making a difference in both our environment and the causes we support. We sell reusable shopping bags which 15% of the proceeds go to charities. localvidsdotne localvidsdotne bag bags charitable charity donations eco ecobags environment environmentally friendly green grocery mesh movement multipack non non-woven nonwoven polyester reusable shopping the wholesale woven nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Pilates Fitness Evolution Wed, 15 Oct 2008 16:34:46 -0800

Author: localvidsdotne
Added: Wed, 15 Oct 2008 16:34:46 -0800
Duration: 50

Call Pilates Fitness Evolution in Southfield, MI at (248) 327-4705. Elite athlete, a stay at home mom, recovering from an injury, or just wanting to start an exercise program, pilates can help you achieve your goals.

]]> centercertifiedclasscoursefitnessgolfgymgyrotonicmatmipilatesplatepostnatalpowerprenatalreformersouthfieldstottstudioworkout http://revver.com/video/1247695/pilates-fitness-evolution/ http://revver.com/watch/1247695 Pilates Fitness Evolution Call Pilates Fitness Evolution in Southfield, MI at (248) 327-4705. Elite athlete, a stay at home mom, recovering from an injury, or just wanting to start an exercise program, pilates can help you achieve your goals. Call Pilates Fitness Evolution in Southfield, MI at (248) 327-4705. Elite athlete, a stay at home mom, recovering from an injury, or just wanting to start an exercise program, pilates can help you achieve your goals. localvidsdotne localvidsdotne center certified class course fitness golf gym gyrotonic mat mi pilates plate postnatal power prenatal reformer southfield stott studio workout nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ CertaPro Painters Tue, 14 Oct 2008 16:34:41 -0800

Author: localvidsdotne
Added: Tue, 14 Oct 2008 16:34:41 -0800
Duration: 47

Call CertaPro in Henderson, NV at (866) 764-7275. Trust us for your interior & exterior house painting needs. Our services are reliable, safe, secure & professional. We have a 2 year warranty for our services.

]]> certacertaprocostestimateexteriorfauxhendersonhomehouseinteriorkitchennvpaintpainterpainterspaintingproresidentialstrippingwall http://revver.com/video/1244199/certapro-painters/ http://revver.com/watch/1244199 CertaPro Painters Call CertaPro in Henderson, NV at (866) 764-7275. Trust us for your interior & exterior house painting needs. Our services are reliable, safe, secure & professional. We have a 2 year warranty for our services. Call CertaPro in Henderson, NV at (866) 764-7275. Trust us for your interior & exterior house painting needs. Our services are reliable, safe, secure & professional. We have a 2 year warranty for our services. localvidsdotne localvidsdotne certa certapro cost estimate exterior faux henderson home house interior kitchen nv paint painter painters painting pro residential stripping wall nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Clean As New Tue, 14 Oct 2008 14:53:56 -0800

Author: localvidsdotne
Added: Tue, 14 Oct 2008 14:53:56 -0800
Duration: 47

Call Clean as New in North Miami Beach, FL (305) 432-9769. Our company cleans and restores houses, buildings, and boats to their original "clean as new" look. Call us today, so we can do the cleaning for you!

]]> 33162beachcompanycontractorcostestimateexpertflhomelowmiaminorthpowerpressurepriceserviceservicesspecialistwashing http://revver.com/video/1244046/clean-as-new/ http://revver.com/watch/1244046 Clean As New Call Clean as New in North Miami Beach, FL (305) 432-9769. Our company cleans and restores houses, buildings, and boats to their original "clean as new" look. Call us today, so we can do the cleaning for you! Call Clean as New in North Miami Beach, FL (305) 432-9769. Our company cleans and restores houses, buildings, and boats to their original "clean as new" look. Call us today, so we can do the cleaning for you! localvidsdotne localvidsdotne 33162 beach company contractor cost estimate expert fl home low miami north power pressure price service services specialist washing nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Work At Home, FastPCProfits.com, Mount Morris, MI, Home Business Mon, 13 Oct 2008 22:53:51 -0800

Author: localvidsdotne
Added: Mon, 13 Oct 2008 22:53:51 -0800
Duration: 37

Call FastPcProfits.com in Mount Morris, MI at 810-515-7760. Allowing average people to immediately earn above average income. Our business model is proven and allows you to plug-in immediately. Build a steady income that grows quickly.

]]> atbasedbusinessearnearningfromhomeideasincomeinternetmimorrismountnewonlineopportunitiesopportunitytopwebworkworking http://revver.com/video/1241420/work-at-home-fastpcprofitscom-mount-morris-mi-home-business/ http://revver.com/watch/1241420 Work At Home, FastPCProfits.com, Mount Morris, MI, Home Business Call FastPcProfits.com in Mount Morris, MI at 810-515-7760. Allowing average people to immediately earn above average income. Our business model is proven and allows you to plug-in immediately. Build a steady income that grows quickly. Call FastPcProfits.com in Mount Morris, MI at 810-515-7760. Allowing average people to immediately earn above average income. Our business model is proven and allows you to plug-in immediately. Build a steady income that grows quickly. localvidsdotne localvidsdotne at based business earn earning from home ideas income internet mi morris mount new online opportunities opportunity top web work working nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ RangeGuard.com Mon, 13 Oct 2008 17:53:49 -0800

Author: localvidsdotne
Added: Mon, 13 Oct 2008 17:53:49 -0800
Duration: 36

Call RangeGuard.com at 1-877-886-7757. Keep your children out of harm's way with the Range Safety Guard. It can prevent range related burns by acting as a barrier between the child. Order for your family and friends today.

]]> adjustableappliancesbabyburnburnerchildcooktopequipmentfamilyfireguardheathomekidskitchenproductsrangesafesafetystovestovetoptoddlertop http://revver.com/video/1241214/rangeguardcom/ http://revver.com/watch/1241214 RangeGuard.com Call RangeGuard.com at 1-877-886-7757. Keep your children out of harm's way with the Range Safety Guard. It can prevent range related burns by acting as a barrier between the child. Order for your family and friends today. Call RangeGuard.com at 1-877-886-7757. Keep your children out of harm's way with the Range Safety Guard. It can prevent range related burns by acting as a barrier between the child. Order for your family and friends today. localvidsdotne localvidsdotne adjustable appliances baby burn burner child cooktop equipment family fire guard heat home kids kitchen products range safe safety stove stovetop toddler top nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Exclusively U Salon & Spa Fri, 10 Oct 2008 19:53:28 -0800

Author: localvidsdotne
Added: Fri, 10 Oct 2008 19:53:28 -0800
Duration: 47

Call Exclusively U Salon & Spa, Woodbridge, VA at (703) 496-4426. We are a premier salon and spa personal care destination, where dedicated professionals provide quality customer service to fit your needs. Call Us Today.

]]> beautybodycoloringdayexclusivelyfacialfacialsgiftshairmanicuresmassagenailpedicurepedicuresproductssalonspatreatmentuvawoodbridge http://revver.com/video/1235774/exclusively-u-salon-spa/ http://revver.com/watch/1235774 Exclusively U Salon & Spa Call Exclusively U Salon & Spa, Woodbridge, VA at (703) 496-4426. We are a premier salon and spa personal care destination, where dedicated professionals provide quality customer service to fit your needs. Call Us Today. Call Exclusively U Salon & Spa, Woodbridge, VA at (703) 496-4426. We are a premier salon and spa personal care destination, where dedicated professionals provide quality customer service to fit your needs. Call Us Today. localvidsdotne localvidsdotne beauty body coloring day exclusively facial facials gifts hair manicures massage nail pedicure pedicures products salon spa treatment u va woodbridge nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Holiday Wine Cellar Thu, 09 Oct 2008 15:53:25 -0800

Author: localvidsdotne
Added: Thu, 09 Oct 2008 15:53:25 -0800
Duration: 30

Call Holiday Wine Cellar in Escondido, CA at (760) 208-2856. Your one stop shop for rare and hard to find beer, spirits, wine and champagne. We offer daily wine tastings. Call for more information or visit us today!

]]> alcoholbasketsbeercacellarcigarsenomaticescondidogiftginglassglassesholidaylicquerliquormixopenersrumservingshotspiritssystemtastingtequilavodkawarewhiskeywine http://revver.com/video/1232714/holiday-wine-cellar/ http://revver.com/watch/1232714 Holiday Wine Cellar Call Holiday Wine Cellar in Escondido, CA at (760) 208-2856. Your one stop shop for rare and hard to find beer, spirits, wine and champagne. We offer daily wine tastings. Call for more information or visit us today! Call Holiday Wine Cellar in Escondido, CA at (760) 208-2856. Your one stop shop for rare and hard to find beer, spirits, wine and champagne. We offer daily wine tastings. Call for more information or visit us today! localvidsdotne localvidsdotne alcohol baskets beer ca cellar cigars enomatic escondido gift gin glass glasses holiday licquer liquor mix openers rum serving shot spirits system tasting tequila vodka ware whiskey wine nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ People-Locator-Pro.com Thu, 09 Oct 2008 12:34:09 -0800

Author: localvidsdotne
Added: Thu, 09 Oct 2008 12:34:09 -0800
Duration: 32

Vist People-Locator-Pro.com Free people searches. Complete addresses and telephone numbers revealed for free. Search results include addresses, phone numbers, ages, and background checks.

]]> aaddressbackgroundbestbycheckdirectoryenginesfindfinderfreefriendlocatormissingnamenumberonlinepeoplepersonphonesearchsitessntnwatertown http://revver.com/video/1232661/people-locator-procom/ http://revver.com/watch/1232661 People-Locator-Pro.com Vist People-Locator-Pro.com Free people searches. Complete addresses and telephone numbers revealed for free. Search results include addresses, phone numbers, ages, and background checks. Vist People-Locator-Pro.com Free people searches. Complete addresses and telephone numbers revealed for free. Search results include addresses, phone numbers, ages, and background checks. localvidsdotne localvidsdotne a address background best by check directory engines find finder free friend locator missing name number online people person phone search site ssn tn watertown nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Home Painter, CertaPro Painters Sunrise, FL, Paint Kitchen Wed, 08 Oct 2008 23:53:20 -0800

Author: localvidsdotne
Added: Wed, 08 Oct 2008 23:53:20 -0800
Duration: 48

Call CertaPro Painters in Sunrise, FL at 877-559-2595. Trust us for your interior & exterior house painting needs. Our services are reliable, safe, secure & professional. We have a 2 year warranty for our services.

]]> certacertaprocostestimateexteriorfauxflhomehouseinteriorkitchenpaintpainterpainterspaintingproresidentialstrippingsunrisewall http://revver.com/video/1230686/home-painter-certapro-painters-sunrise-fl-paint-kitchen/ http://revver.com/watch/1230686 Home Painter, CertaPro Painters Sunrise, FL, Paint Kitchen Call CertaPro Painters in Sunrise, FL at 877-559-2595. Trust us for your interior & exterior house painting needs. Our services are reliable, safe, secure & professional. We have a 2 year warranty for our services. Call CertaPro Painters in Sunrise, FL at 877-559-2595. Trust us for your interior & exterior house painting needs. Our services are reliable, safe, secure & professional. We have a 2 year warranty for our services. localvidsdotne localvidsdotne certa certapro cost estimate exterior faux fl home house interior kitchen paint painter painters painting pro residential stripping sunrise wall nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Win Home, Sunshine State Home Raffle, Debary FL, Home Lottery Wed, 08 Oct 2008 06:53:18 -0800

Author: localvidsdotne
Added: Wed, 08 Oct 2008 06:53:18 -0800
Duration: 33

Call the Sunshine State Home Raffle at (386) 492-8473. Register for a chance to win a 3 bedroom home in Debary, FL; and a $50,000 cash prize. A maximum of 7500 chances to win will be offered. Call now for early bird drawing.

]]> cashdebarydrawingdreamflfloridaforfundraiserhomelimitedlotteryprizerafflerelieftaxthisticketticketswin http://revver.com/video/1226128/win-home-sunshine-state-home-raffle-debary-fl-home-lottery/ http://revver.com/watch/1226128 Win Home, Sunshine State Home Raffle, Debary FL, Home Lottery Call the Sunshine State Home Raffle at (386) 492-8473. Register for a chance to win a 3 bedroom home in Debary, FL; and a $50,000 cash prize. A maximum of 7500 chances to win will be offered. Call now for early bird drawing. Call the Sunshine State Home Raffle at (386) 492-8473. Register for a chance to win a 3 bedroom home in Debary, FL; and a $50,000 cash prize. A maximum of 7500 chances to win will be offered. Call now for early bird drawing. localvidsdotne localvidsdotne cash debary drawing dream fl florida for fundraiser home limited lottery prize raffle relief tax this ticket tickets win nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Car Insurance, Miguel Torres Allstate Insurance, Home Insurance Tue, 07 Oct 2008 09:53:11 -0800

Author: localvidsdotne
Added: Tue, 07 Oct 2008 09:53:11 -0800
Duration: 40

Call Miguel Torres, Allstate Insurance Agent in Phoenix, AZ at 623-239-4490. Allstate Insurance Agent, Miguel Torres provides policy coverage that extends to residential and commercial auto and homeowner’s insurance.

]]> affordableautoautomibleautomobileazbestbuycarcarinsurancecheapcommercialcoverageestimatefindgethomeownerhomeownersinsurancephoenixpolicyquotequotesrates http://revver.com/video/1212376/car-insurance-miguel-torres-allstate-insurance-home-insurance/ http://revver.com/watch/1212376 Car Insurance, Miguel Torres Allstate Insurance, Home Insurance Call Miguel Torres, Allstate Insurance Agent in Phoenix, AZ at 623-239-4490. Allstate Insurance Agent, Miguel Torres provides policy coverage that extends to residential and commercial auto and homeowner’s insurance. Call Miguel Torres, Allstate Insurance Agent in Phoenix, AZ at 623-239-4490. Allstate Insurance Agent, Miguel Torres provides policy coverage that extends to residential and commercial auto and homeowner’s insurance. localvidsdotne localvidsdotne affordable auto automible automobile az best buy car carinsurance cheap commercial coverage estimate find get homeowner homeowners insurance phoenix policy quote quotes rates nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Home Painter, CertaPro Painters Spring TX, Paint Kitchen Sat, 04 Oct 2008 21:52:53 -0800

Author: localvidsdotne
Added: Sat, 04 Oct 2008 21:52:53 -0800
Duration: 45

Call CertaPro Painters at 888-312-5517 Trust us for your interior & exterior house painting needs. Our services are reliable, safe, secure & professional. We have a 2 year warranty for our services.

]]> certacertaprocostestimateexteriorfauxhomehouseinteriorkitchenpaintpainterpainterspaintingproresidentialspringstrippingtxwall http://revver.com/video/1204419/home-painter-certapro-painters-spring-tx-paint-kitchen/ http://revver.com/watch/1204419 Home Painter, CertaPro Painters Spring TX, Paint Kitchen Call CertaPro Painters at 888-312-5517 Trust us for your interior & exterior house painting needs. Our services are reliable, safe, secure & professional. We have a 2 year warranty for our services. Call CertaPro Painters at 888-312-5517 Trust us for your interior & exterior house painting needs. Our services are reliable, safe, secure & professional. We have a 2 year warranty for our services. localvidsdotne localvidsdotne certa certapro cost estimate exterior faux home house interior kitchen paint painter painters painting pro residential spring stripping tx wall nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ CertaPro - Orlando Thu, 02 Oct 2008 16:33:29 -0800

Author: localvidsdotne
Added: Thu, 02 Oct 2008 16:33:29 -0800
Duration: 51

Call CertaPro Painters at (877) 280-6187. Trust us for your interior & exterior house painting needs. Our services are reliable, safe, secure & professional. We have a 2 year warranty for our services.

]]> certacertaprocostestimateexteriorfauxflhomehouseinteriorkitchenorlandopaintpainterpainterspaintingproresidentialstrippingwall http://revver.com/video/1218481/certapro-orlando/ http://revver.com/watch/1218481 CertaPro - Orlando Call CertaPro Painters at (877) 280-6187. Trust us for your interior & exterior house painting needs. Our services are reliable, safe, secure & professional. We have a 2 year warranty for our services. Call CertaPro Painters at (877) 280-6187. Trust us for your interior & exterior house painting needs. Our services are reliable, safe, secure & professional. We have a 2 year warranty for our services. localvidsdotne localvidsdotne certa certapro cost estimate exterior faux fl home house interior kitchen orlando paint painter painters painting pro residential stripping wall nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Windows, Panoramic Windows, Mangotsfield, Bristol, Conservatory Thu, 02 Oct 2008 08:33:23 -0800

Author: localvidsdotne
Added: Thu, 02 Oct 2008 08:33:23 -0800
Duration: 47

Call Panoramic Windows in Mangotsfield, Bristol at 0808-120-2910. Double glazing, doors and conservatories. Providing top quality windows, doors & conservatories in a variety of materials at affordable prices, with exceptional service.

]]> bristolcolouredcompositeconservatoriesconvervatoriesdoordoorsdoubleglazinggaragegardenmangotsfieldpanoramicporchproductspvcurepairroomsolariumsunroomtimbervinylwindowwindows http://revver.com/video/1186422/windows-panoramic-windows-mangotsfield-bristol-conservatory/ http://revver.com/watch/1186422 Windows, Panoramic Windows, Mangotsfield, Bristol, Conservatory Call Panoramic Windows in Mangotsfield, Bristol at 0808-120-2910. Double glazing, doors and conservatories. Providing top quality windows, doors & conservatories in a variety of materials at affordable prices, with exceptional service. Call Panoramic Windows in Mangotsfield, Bristol at 0808-120-2910. Double glazing, doors and conservatories. Providing top quality windows, doors & conservatories in a variety of materials at affordable prices, with exceptional service. localvidsdotne localvidsdotne bristol coloured composite conservatories convervatories door doors doubleglazing garage garden mangotsfield panoramic porch products pvcu repair room solarium sunroom timber vinyl window windows nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ general contractor, Millennium Contracting Inc, Kissimmee, FL Wed, 01 Oct 2008 18:56:53 -0800

Author: localvidsdotne
Added: Wed, 01 Oct 2008 18:56:53 -0800
Duration: 55

Call Millennium Contracting Inc. in Kissimmee, FL at (407) 477 - 4204. We do custom homes, commercial buildings, general building maintanence and repair, and perform general contractor services. Call Today for your free estimate.

]]> buildbuildingbuildingscommercialconstructioncontractordesignsgeneralhomehomeshousemaintenancenewplansrenovationrepair http://revver.com/video/1215273/general-contractor-millennium-contracting-inc-kissimmee-fl/ http://revver.com/watch/1215273 general contractor, Millennium Contracting Inc, Kissimmee, FL Call Millennium Contracting Inc. in Kissimmee, FL at (407) 477 - 4204. We do custom homes, commercial buildings, general building maintanence and repair, and perform general contractor services. Call Today for your free estimate. Call Millennium Contracting Inc. in Kissimmee, FL at (407) 477 - 4204. We do custom homes, commercial buildings, general building maintanence and repair, and perform general contractor services. Call Today for your free estimate. localvidsdotne localvidsdotne build building buildings commercial construction contractor designs general home homes house maintenance new plans renovation repair nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Home Painter, CertaPro Painters Jacksonville FL, Paint Kitchen Tue, 30 Sep 2008 17:52:33 -0800

Author: localvidsdotne
Added: Tue, 30 Sep 2008 17:52:33 -0800
Duration: 45

Call CertaPro Painters at (888) 309-8039. Trust us for your interior & exterior house painting needs. Our services are reliable, safe, secure & professional. We have a 2 year warranty for our services.

]]> certacertaprocostestimateexteriorfauxflhomehouseinteriorjacksonvillekitchenpaintpainterpainterspaintingproresidentialstrippingwall http://revver.com/video/1211264/home-painter-certapro-painters-jacksonville-fl-paint-kitchen/ http://revver.com/watch/1211264 Home Painter, CertaPro Painters Jacksonville FL, Paint Kitchen Call CertaPro Painters at (888) 309-8039. Trust us for your interior & exterior house painting needs. Our services are reliable, safe, secure & professional. We have a 2 year warranty for our services. Call CertaPro Painters at (888) 309-8039. Trust us for your interior & exterior house painting needs. Our services are reliable, safe, secure & professional. We have a 2 year warranty for our services. localvidsdotne localvidsdotne certa certapro cost estimate exterior faux fl home house interior jacksonville kitchen paint painter painters painting pro residential stripping wall nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Home Painter, CertaPro Painters Salt Lake City UT, Paint Kitchen Fri, 26 Sep 2008 19:53:09 -0800

Author: localvidsdotne
Added: Fri, 26 Sep 2008 19:53:09 -0800
Duration: 45

Call CertaPro Painters at 866-321-4109. Trust us for your interior & exterior house painting needs. Our services are reliable, safe, secure & professional. We have a 2 year warranty for our services.

]]> certacertaprocitycostestimateexteriorfauxhomehouseinteriorkitchenlakepaintpainterpainterspaintingproresidentialsaltstrippingutwall http://revver.com/video/1204432/home-painter-certapro-painters-salt-lake-city-ut-paint-kitchen/ http://revver.com/watch/1204432 Home Painter, CertaPro Painters Salt Lake City UT, Paint Kitchen Call CertaPro Painters at 866-321-4109. Trust us for your interior & exterior house painting needs. Our services are reliable, safe, secure & professional. We have a 2 year warranty for our services. Call CertaPro Painters at 866-321-4109. Trust us for your interior & exterior house painting needs. Our services are reliable, safe, secure & professional. We have a 2 year warranty for our services. localvidsdotne localvidsdotne certa certapro city cost estimate exterior faux home house interior kitchen lake paint painter painters painting pro residential salt stripping ut wall nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Home Painter, CertaPro Painters Gainesville FL, Paint Kitchen Fri, 26 Sep 2008 16:33:56 -0800

Author: localvidsdotne
Added: Fri, 26 Sep 2008 16:33:56 -0800
Duration: 51

Call CertaPro Painters at 888-476-1332. Trust us for your interior & exterior house painting needs. Our services are reliable, safe, secure & professional. We have a 2 year warranty for our services.

]]> certacertaprocostestimateexteriorfauxflgainesvillehomehouseinteriorkitchenpaintpainterpainterspaintingproresidentialstrippingwall http://revver.com/video/1204395/home-painter-certapro-painters-gainesville-fl-paint-kitchen/ http://revver.com/watch/1204395 Home Painter, CertaPro Painters Gainesville FL, Paint Kitchen Call CertaPro Painters at 888-476-1332. Trust us for your interior & exterior house painting needs. Our services are reliable, safe, secure & professional. We have a 2 year warranty for our services. Call CertaPro Painters at 888-476-1332. Trust us for your interior & exterior house painting needs. Our services are reliable, safe, secure & professional. We have a 2 year warranty for our services. localvidsdotne localvidsdotne certa certapro cost estimate exterior faux fl gainesville home house interior kitchen paint painter painters painting pro residential stripping wall nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Sofas & Chairs, Park Furnishers, Bedminster, Bristol, Leather Thu, 25 Sep 2008 15:53:28 -0800

Author: localvidsdotne
Added: Thu, 25 Sep 2008 15:53:28 -0800
Duration: 43

Call Park Furnishers in Bedminster, Bristol (0117-911-8988). Bristol's largest furniture store, founded in 1967. We have a massive range of furniture and believe we offer the best selection in Bristol.

]]> adjustublebedbedminsterbedroombedsbristolcarpetcarpetschairscontemporarydiningeuropeanfabricflooringfurnitureleathermattressmodernoakpilerugsetshaggysofaswool http://revver.com/video/1183697/sofas-chairs-park-furnishers-bedminster-bristol-leather/ http://revver.com/watch/1183697 Sofas & Chairs, Park Furnishers, Bedminster, Bristol, Leather Call Park Furnishers in Bedminster, Bristol (0117-911-8988). Bristol's largest furniture store, founded in 1967. We have a massive range of furniture and believe we offer the best selection in Bristol. Call Park Furnishers in Bedminster, Bristol (0117-911-8988). Bristol's largest furniture store, founded in 1967. We have a massive range of furniture and believe we offer the best selection in Bristol. localvidsdotne localvidsdotne adjustuble bed bedminster bedroom beds bristol carpet carpets chairs contemporary dining european fabric flooring furniture leather mattress modern oak pile rug set shaggy sofas wool nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ hypoxic training, AltoLab, Tempe, AZ, oxygen efficiency Fri, 19 Sep 2008 19:52:56 -0800

Author: localvidsdotne
Added: Fri, 19 Sep 2008 19:52:56 -0800
Duration: 114

Call AltoLab in Tempe, AZ at (888) 414-6069. We specialize in providing athletes with intermittent hypoxic training through our revolutionary device. Athletes can perform at their best and recover faster. Call us today.

]]> aidazbreathingdeviceefficiencyextrafuelhypoxicmaskoxygensportssupplementtempetooltraining http://revver.com/video/1189013/hypoxic-training-altolab-tempe-az-oxygen-efficiency/ http://revver.com/watch/1189013 hypoxic training, AltoLab, Tempe, AZ, oxygen efficiency Call AltoLab in Tempe, AZ at (888) 414-6069. We specialize in providing athletes with intermittent hypoxic training through our revolutionary device. Athletes can perform at their best and recover faster. Call us today. Call AltoLab in Tempe, AZ at (888) 414-6069. We specialize in providing athletes with intermittent hypoxic training through our revolutionary device. Athletes can perform at their best and recover faster. Call us today. localvidsdotne localvidsdotne aid az breathing device efficiency extra fuel hypoxic mask oxygen sports supplement tempe tool training nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ hypoxic training, AltoLab, Tempe, AZ, oxygen efficiency Thu, 18 Sep 2008 20:36:39 -0800

Author: localvidsdotne
Added: Thu, 18 Sep 2008 20:36:39 -0800
Duration: 114

Call AltoLab in Tempe, AZ at (888) 414-6069. We specialize in providing athletes with intermittent hypoxic training through our revolutionary device. Athletes can perform at their best and recover faster. Call us today.

]]> aidazbreathingdeviceefficiencyextrafuelhypoxicmaskoxygensportssupplementtempetooltraining http://revver.com/video/1186811/hypoxic-training-altolab-tempe-az-oxygen-efficiency/ http://revver.com/watch/1186811 hypoxic training, AltoLab, Tempe, AZ, oxygen efficiency Call AltoLab in Tempe, AZ at (888) 414-6069. We specialize in providing athletes with intermittent hypoxic training through our revolutionary device. Athletes can perform at their best and recover faster. Call us today. Call AltoLab in Tempe, AZ at (888) 414-6069. We specialize in providing athletes with intermittent hypoxic training through our revolutionary device. Athletes can perform at their best and recover faster. Call us today. localvidsdotne localvidsdotne aid az breathing device efficiency extra fuel hypoxic mask oxygen sports supplement tempe tool training nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Watch Repair, Premier Watch Repairs, Yate, Bristol, Watchmaker Thu, 18 Sep 2008 17:55:47 -0800

Author: localvidsdotne
Added: Thu, 18 Sep 2008 17:55:47 -0800
Duration: 47

Call Premier Watch Repairs in Yate, Bristol at 0808-120-2922. Premier watch Repairs has been specialising in the repair of quality Swiss, Japanese and Russian watches from its Bristol based workshop since 2002.

]]> braceletbristolbuycleaningcollectiondesignerfashionfixfreeheuermaintenanceonlinepartsrepairreplacementreturnsecureservicingsportsstoretagwatchwatcheswatchmakeryate http://revver.com/video/1186479/watch-repair-premier-watch-repairs-yate-bristol-watchmaker/ http://revver.com/watch/1186479 Watch Repair, Premier Watch Repairs, Yate, Bristol, Watchmaker Call Premier Watch Repairs in Yate, Bristol at 0808-120-2922. Premier watch Repairs has been specialising in the repair of quality Swiss, Japanese and Russian watches from its Bristol based workshop since 2002. Call Premier Watch Repairs in Yate, Bristol at 0808-120-2922. Premier watch Repairs has been specialising in the repair of quality Swiss, Japanese and Russian watches from its Bristol based workshop since 2002. localvidsdotne localvidsdotne bracelet bristol buy cleaning collection designer fashion fix free heuer maintenance online parts repair replacement return secure servicing sports store tag watch watches watchmaker yate nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Appliances, Kitchen Vision, Stapleford, Nottingham, Worktops Thu, 18 Sep 2008 15:55:46 -0800

Author: localvidsdotne
Added: Thu, 18 Sep 2008 15:55:46 -0800
Duration: 43

Call Kitchen Vision in Stapleford, Nottingham at 0115-871-4971. Professional service specialising in fully fitted kitchens, bedrooms, appliances, general building work, electrical, plumbing work and tiling. Call today!

]]> applianceappliancesbedroombedroomscustomextensionfittingfixturesgranitehupinstalledkitchenlaminatenottinghamovenrangesremodelsilestonestaplefordunitswoodworktopworktops http://revver.com/video/1186109/appliances-kitchen-vision-stapleford-nottingham-worktops/ http://revver.com/watch/1186109 Appliances, Kitchen Vision, Stapleford, Nottingham, Worktops Call Kitchen Vision in Stapleford, Nottingham at 0115-871-4971. Professional service specialising in fully fitted kitchens, bedrooms, appliances, general building work, electrical, plumbing work and tiling. Call today! Call Kitchen Vision in Stapleford, Nottingham at 0115-871-4971. Professional service specialising in fully fitted kitchens, bedrooms, appliances, general building work, electrical, plumbing work and tiling. Call today! localvidsdotne localvidsdotne appliance appliances bedroom bedrooms custom extension fitting fixtures granite hup installed kitchen laminate nottingham oven ranges remodel silestone stapleford units wood worktop worktops nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ life insurance, Balanced Financial Solutions, health insurance Wed, 17 Sep 2008 17:55:45 -0800

Author: localvidsdotne
Added: Wed, 17 Sep 2008 17:55:45 -0800
Duration: 37

Call Balanced Financial Solutions at 888-312-3941 We provide life, health, disability and long term care insurance quotes from some of the largest, most reliable insurance carriers in the world.

]]> agentsannuitiescancerclaimscompanycostcoveragedisabilityequityforhealthhomeindexedinformationinsurancelifelonglowmedicalonlinepersonalisedpersonnelpoliceprovidersquotesterm http://revver.com/video/1171016/life-insurance-balanced-financial-solutions-health-insurance/ http://revver.com/watch/1171016 life insurance, Balanced Financial Solutions, health insurance Call Balanced Financial Solutions at 888-312-3941 We provide life, health, disability and long term care insurance quotes from some of the largest, most reliable insurance carriers in the world. Call Balanced Financial Solutions at 888-312-3941 We provide life, health, disability and long term care insurance quotes from some of the largest, most reliable insurance carriers in the world. localvidsdotne localvidsdotne agents annuities cancer claims company cost coverage disability equity for health home indexed information insurance life long low medical online personalised personnel police providers quotes term nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ printing, Ink Impressions, Cypress, TX, promotional service Wed, 17 Sep 2008 17:55:45 -0800

Author: localvidsdotne
Added: Wed, 17 Sep 2008 17:55:45 -0800
Duration: 39

Call Ink Impressions in Cypress, TX at (281) 509-9241. Your source for online printing and branded merchandise! Ink Impressions services Houston and surrounding communities, as well as the nation. Over 20 years of experience!

]]> 4bannersbumperbusinesscolorcorporatecypressdigitalformsfour-coloridentitylabelsletterheadsmedicaloffsetonlinepackagepostersprinterprintersprintingprintsprofessionalpromotionalservicesshopsolutionstickerstx http://revver.com/video/1184218/printing-ink-impressions-cypress-tx-promotional-service/ http://revver.com/watch/1184218 printing, Ink Impressions, Cypress, TX, promotional service Call Ink Impressions in Cypress, TX at (281) 509-9241. Your source for online printing and branded merchandise! Ink Impressions services Houston and surrounding communities, as well as the nation. Over 20 years of experience! Call Ink Impressions in Cypress, TX at (281) 509-9241. Your source for online printing and branded merchandise! Ink Impressions services Houston and surrounding communities, as well as the nation. Over 20 years of experience! localvidsdotne localvidsdotne 4 banners bumper business color corporate cypress digital forms four-color identity labels letterheads medical offset online package posters printer printers printing prints professional promotional services shop solution stickers tx nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Eyelash Extension, Marcia Walden Studio, Albany CA, Eyelash Perm Sat, 13 Sep 2008 06:55:19 -0800

Author: localvidsdotne
Added: Sat, 13 Sep 2008 06:55:19 -0800
Duration: 44

Call Marcia Walden Studio in Albany, CA (510-984-2657) Your appointment includes you sharing your eyebrow design ideas, which we'll couple with my eyebrow design expertise. Together we'll design the perfect eyebrow just for you.

]]> aestheticianalbanyartistbodybraziliancademidesignextentionseyebroweyelasheyelashesfacialfacialsglitznowlashlashesmakeuppermpermanentsalonsetshapingstudiowaxwaxingwedding http://revver.com/video/1173032/eyelash-extension-marcia-walden-studio-albany-ca-eyelash-perm/ http://revver.com/watch/1173032 Eyelash Extension, Marcia Walden Studio, Albany CA, Eyelash Perm Call Marcia Walden Studio in Albany, CA (510-984-2657) Your appointment includes you sharing your eyebrow design ideas, which we'll couple with my eyebrow design expertise. Together we'll design the perfect eyebrow just for you. Call Marcia Walden Studio in Albany, CA (510-984-2657) Your appointment includes you sharing your eyebrow design ideas, which we'll couple with my eyebrow design expertise. Together we'll design the perfect eyebrow just for you. localvidsdotne localvidsdotne aesthetician albany artist body brazilian ca demi design extentions eyebrow eyelash eyelashes facial facials glitznow lash lashes makeup perm permanent salon set shaping studio wax waxing wedding nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Pain Management, Pain Control Institute, Inc., Dallas, TX Thu, 11 Sep 2008 09:55:43 -0800

Author: localvidsdotne
Added: Thu, 11 Sep 2008 09:55:43 -0800
Duration: 62

Call the Pain Control Institute, Inc. in Dallas, TX at 214-989-4755. The Dallas-based Pain Control Institute uses state-of-the-art pain management techniques for soft-tissue injuries mainly of the neck and back caused by car accidents. Our less invasive, drug-free approach delivers relief and helps patients return quickly to their regular routine.

]]> accidentautobackchiropracticchronicdoctorhandsinjuriesinjurymanagementmechanicalneckonpainpainsphysicianreliefservicesoftspecialistspecialiststherapisttherapytissuetractiontreattreatmentswhiplash http://revver.com/video/1167812/pain-management-pain-control-institute-inc-dallas-tx/ http://revver.com/watch/1167812 Pain Management, Pain Control Institute, Inc., Dallas, TX Call the Pain Control Institute, Inc. in Dallas, TX at 214-989-4755. The Dallas-based Pain Control Institute uses state-of-the-art pain management techniques for soft-tissue injuries mainly of the neck and back caused by car accidents. Our less invasive, drug-free approach delivers relief and helps patients return quickly to their regular routine. Call the Pain Control Institute, Inc. in Dallas, TX at 214-989-4755. The Dallas-based Pain Control Institute uses state-of-the-art pain management techniques for soft-tissue injuries mainly of the neck and back caused by car accidents. Our less invasive, drug-free approach delivers relief and helps patients return quickly to their regular routine. localvidsdotne localvidsdotne accident auto back chiropractic chronic doctor hands injuries injury management mechanical neck on pain pains physician relief service soft specialist specialists therapist therapy tissue traction treat treatments whiplash nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Digital Media, RhythmQwest Entertainment, Miramar, Music Videos Wed, 10 Sep 2008 21:55:42 -0800

Author: localvidsdotne
Added: Wed, 10 Sep 2008 21:55:42 -0800
Duration: 36

RhythmQwest Entertainment and RhythmQwest.com, your window to the world of entertainment. We strive to make the purchase of digital music, concerts, films, audio books and music videos quick, easy and affordable.

]]> audioaudiobooksbypassconcertconcertscontentdigintaldigitaldistributiondjdownloadselectronicentertainmentfilesfilmfilmsfllabelsmiramarmixesmp3musiconlineprogramsrecordingsshowstvvideovideos http://revver.com/video/1167387/digital-media-rhythmqwest-entertainment-miramar-music-videos/ http://revver.com/watch/1167387 Digital Media, RhythmQwest Entertainment, Miramar, Music Videos RhythmQwest Entertainment and RhythmQwest.com, your window to the world of entertainment. We strive to make the purchase of digital music, concerts, films, audio books and music videos quick, easy and affordable. RhythmQwest Entertainment and RhythmQwest.com, your window to the world of entertainment. We strive to make the purchase of digital music, concerts, films, audio books and music videos quick, easy and affordable. localvidsdotne localvidsdotne audio audiobooks bypass concert concerts content digintal digital distribution dj downloads electronic entertainment files film films fl labels miramar mixes mp3 music online programs recordings shows tv video videos nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Paint Home, CertaPro Painters Santa Monica, Paint Color Matching Mon, 08 Sep 2008 15:55:28 -0800

Author: localvidsdotne
Added: Mon, 08 Sep 2008 15:55:28 -0800
Duration: 47

Call CertaPro Painters in Santa Monica, CA (877-492-6957). Trust us for your interior & exterior house painting needs. Our services are reliable, safe, secure & professional. We have a 2 year warranty for our services.

]]> acryliccabinetcolorconcretecostcustomexteriorfauxflgainesvilleglazinghomehouseinteriorkitchenmatchingpaintpainterpainterspaintingsherwinstuccowallwilliams http://revver.com/video/1161518/paint-home-certapro-painters-santa-monica-paint-color-matching/ http://revver.com/watch/1161518 Paint Home, CertaPro Painters Santa Monica, Paint Color Matching Call CertaPro Painters in Santa Monica, CA (877-492-6957). Trust us for your interior & exterior house painting needs. Our services are reliable, safe, secure & professional. We have a 2 year warranty for our services. Call CertaPro Painters in Santa Monica, CA (877-492-6957). Trust us for your interior & exterior house painting needs. Our services are reliable, safe, secure & professional. We have a 2 year warranty for our services. localvidsdotne localvidsdotne acrylic cabinet color concrete cost custom exterior faux fl gainesville glazing home house interior kitchen matching paint painter painters painting sherwin stucco wall williams nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ fishing tackle, Port A Outfitters, Port Aransas, TX, equipment Mon, 08 Sep 2008 15:55:28 -0800

Author: localvidsdotne
Added: Mon, 08 Sep 2008 15:55:28 -0800
Duration: 41

Call Port "A" Outfitters in Port Aransas, TX at 361-226-1230. Port A Outfiiters has a great supply of tackle, clothing, and accessories, all at one location. Shop Port "A" Outfitters for all your fishing needs. Call today!

]]> aaransasbagbaitbuyclothingdealerdecoyequipmentfishfishingflygearoutfitterspoleportreelrodsaleseashirtshopstoresunglassessuppliersurftackletx http://revver.com/video/1161550/fishing-tackle-port-a-outfitters-port-aransas-tx-equipment/ http://revver.com/watch/1161550 fishing tackle, Port A Outfitters, Port Aransas, TX, equipment Call Port "A" Outfitters in Port Aransas, TX at 361-226-1230. Port A Outfiiters has a great supply of tackle, clothing, and accessories, all at one location. Shop Port "A" Outfitters for all your fishing needs. Call today! Call Port "A" Outfitters in Port Aransas, TX at 361-226-1230. Port A Outfiiters has a great supply of tackle, clothing, and accessories, all at one location. Shop Port "A" Outfitters for all your fishing needs. Call today! localvidsdotne localvidsdotne a aransas bag bait buy clothing dealer decoy equipment fish fishing fly gear outfitters pole port reel rod sale sea shirt shop store sunglasses supplier surf tackle tx nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Paint Home, CertaPro Painters, Spring, TX, Paint Color Matching Mon, 08 Sep 2008 13:55:29 -0800

Author: localvidsdotne
Added: Mon, 08 Sep 2008 13:55:29 -0800
Duration: 34

Call CertaPro Painters in Spring, TX 888-312-5517 Trust us for your interior & exterior house painting needs. Our services are reliable, safe, secure & professional. We have a 2 year warranty for our services.

]]> acryliccabinetcolorconcretecostcustomexteriorfauxflgainesvilleglazinghomehouseinteriorkitchenmatchingpaintpainterpainterspaintingsherwinstuccowallwilliams http://revver.com/video/1161491/paint-home-certapro-painters-spring-tx-paint-color-matching/ http://revver.com/watch/1161491 Paint Home, CertaPro Painters, Spring, TX, Paint Color Matching Call CertaPro Painters in Spring, TX 888-312-5517 Trust us for your interior & exterior house painting needs. Our services are reliable, safe, secure & professional. We have a 2 year warranty for our services. Call CertaPro Painters in Spring, TX 888-312-5517 Trust us for your interior & exterior house painting needs. Our services are reliable, safe, secure & professional. We have a 2 year warranty for our services. localvidsdotne localvidsdotne acrylic cabinet color concrete cost custom exterior faux fl gainesville glazing home house interior kitchen matching paint painter painters painting sherwin stucco wall williams nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Handyman, Handyman Connections, Ajax, ON, Home Improvement Mon, 08 Sep 2008 13:55:29 -0800

Author: localvidsdotne
Added: Mon, 08 Sep 2008 13:55:29 -0800
Duration: 38

Handyman Connection® - One Call Gets The Things You Want Done ... DONE® From small home repairs to improvements, you can trust the Professionals at Handyman Connection to: Service, Paint, Patch, Replace, Fix, Install, Repair, Maintain and Remodel - just about anything! Conveniently Located in Pasadena, CA Handyman Connection has been taking the worry and stress out of home improvement, repairs and remodeling for homeowners since 1990 - we are the Original & Trusted Home Improvements Specialists (SM) Handyman Connection > Home Improvements - Done Right. Done Quick. Guaranteed

]]> contractorhandymancontractorhomehandyhandymanhomehandymanlicensedhomeimprovementimprovementhandymanimprovementhomemanhomeplumbinghandymanremodelingremodelinghandymanrenovationhomerepairhandymanrepairhandymanhandymanservicehandymanworkhome http://revver.com/video/1161433/handyman-handyman-connections-ajax-on-home-improvement/ http://revver.com/watch/1161433 Handyman, Handyman Connections, Ajax, ON, Home Improvement Handyman Connection® - One Call Gets The Things You Want Done ... DONE® From small home repairs to improvements, you can trust the Professionals at Handyman Connection to: Service, Paint, Patch, Replace, Fix, Install, Repair, Maintain and Remodel - just about anything! Conveniently Located in Pasadena, CA Handyman Connection has been taking the worry and stress out of home improvement, repairs and remodeling for homeowners since 1990 - we are the Original & Trusted Home Improvements Specialists (SM) Handyman Connection > Home Improvements - Done Right. Done Quick. Guaranteed Handyman Connection® - One Call Gets The Things You Want Done ... DONE® From small home repairs to improvements, you can trust the Professionals at Handyman Connection to: Service, Paint, Patch, Replace, Fix, Install, Repair, Maintain and Remodel - just about anything! Conveniently Located in Pasadena, CA Handyman Connection has been taking the worry and stress out of home improvement, repairs and remodeling for homeowners since 1990 - we are the Original & Trusted Home Improvements Specialists (SM) Handyman Connection > Home Improvements - Done Right. Done Quick. Guaranteed localvidsdotne localvidsdotne contractorhandyman contractorhome handy handymanhome handymanlicensed home improvement improvementhandyman improvementhome manhome plumbinghandyman remodeling remodelinghandyman renovationhome repairhandyman repairhandymanhandyman servicehandyman workhome nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ cosmetic packaging, Cosmeticpack, South Burlington VT, container Fri, 05 Sep 2008 19:55:13 -0800

Author: localvidsdotne
Added: Fri, 05 Sep 2008 19:55:13 -0800
Duration: 42

Call Cosmeticpack in South Burlington, VT at 802-316-4318. We specialize in all types of cosmetic packaging. Great pricing and customer service are waiting. Give us a call or visit our website today!

]]> boxboxesburlingtoncarecontainercosmeticcosmeticpackdesignglassmanufacturermaterialpackpackagepackagingpersonalplasticproductsamplesouthsuppliersuppliessupplytubeuniquevtwholesale http://revver.com/video/1155739/cosmetic-packaging-cosmeticpack-south-burlington-vt-container/ http://revver.com/watch/1155739 cosmetic packaging, Cosmeticpack, South Burlington VT, container Call Cosmeticpack in South Burlington, VT at 802-316-4318. We specialize in all types of cosmetic packaging. Great pricing and customer service are waiting. Give us a call or visit our website today! Call Cosmeticpack in South Burlington, VT at 802-316-4318. We specialize in all types of cosmetic packaging. Great pricing and customer service are waiting. Give us a call or visit our website today! localvidsdotne localvidsdotne box boxes burlington care container cosmetic cosmeticpack design glass manufacturer material pack package packaging personal plastic product sample south supplier supplies supply tube unique vt wholesale nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ video telephone, Voice Vision, San Diego, CA, video conference Fri, 05 Sep 2008 16:35:54 -0800

Author: localvidsdotne
Added: Fri, 05 Sep 2008 16:35:54 -0800
Duration: 62

Call Voice Vision in San Diego, CA at 858-952-1846. Voice Vision routes phone calls directly to a telephone using high speed internet connections, instead of using high priced telephone companies. Try it out today!

]]> broadbandbroadcastcallcommunicationconferencingdigitalhighinternetiponlineoverphoneprotocolproviderresolutionroutingservicesupporttelephonevideovideophonevoicevoipweb http://revver.com/video/1155814/video-telephone-voice-vision-san-diego-ca-video-conference/ http://revver.com/watch/1155814 video telephone, Voice Vision, San Diego, CA, video conference Call Voice Vision in San Diego, CA at 858-952-1846. Voice Vision routes phone calls directly to a telephone using high speed internet connections, instead of using high priced telephone companies. Try it out today! Call Voice Vision in San Diego, CA at 858-952-1846. Voice Vision routes phone calls directly to a telephone using high speed internet connections, instead of using high priced telephone companies. Try it out today! localvidsdotne localvidsdotne broadband broadcast call communication conferencing digital high internet ip online over phone protocol provider resolution routing service support telephone video videophone voice voip web nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bond Paper, PlotterMedia.com, Cerritos, CA, Drafting Film Fri, 05 Sep 2008 14:55:11 -0800

Author: localvidsdotne
Added: Fri, 05 Sep 2008 14:55:11 -0800
Duration: 37

Call PlotterMedia.com in Cerritos, CA (888) 839-9143 We have the best deals on bond paper, drafting film, and vellum. Save up to 40% off MSRP on graphic paper supplies, offering the lowest prices in the industry!

]]> bestbondcacerritoscolordealsdoubledraftingerasablefilmfilmdoubleinkjetmatteonpaperpenplotterpremiumreversalsingletranslucentvellumxerographic http://revver.com/video/1155145/bond-paper-plottermediacom-cerritos-ca-drafting-film/ http://revver.com/watch/1155145 Bond Paper, PlotterMedia.com, Cerritos, CA, Drafting Film Call PlotterMedia.com in Cerritos, CA (888) 839-9143 We have the best deals on bond paper, drafting film, and vellum. Save up to 40% off MSRP on graphic paper supplies, offering the lowest prices in the industry! Call PlotterMedia.com in Cerritos, CA (888) 839-9143 We have the best deals on bond paper, drafting film, and vellum. Save up to 40% off MSRP on graphic paper supplies, offering the lowest prices in the industry! localvidsdotne localvidsdotne best bond ca cerritos color deals double drafting erasable film filmdouble inkjet matte on paper pen plotter premium reversal single translucent vellum xerographic nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ drug abuse rehab The Last Resort PA, Rehabilitation Treatment Center Wed, 03 Sep 2008 19:54:59 -0800

Author: localvidsdotne
Added: Wed, 03 Sep 2008 19:54:59 -0800
Duration: 37

Call The Last Resort PA at (239) 494-6908. The Last Resort Pa's drug and alcohol rehab has an experienced staff, as well as superb facilities to help facilitate the recovery process of the Mind, Body and Spirit of those in need.

]]> abuseaddictionalcoholcenterdependencydetoxdrughelprecoveryrehabsubstancetreatment http://revver.com/video/1150752/drug-abuse-rehab-the-last-resort-pa-rehabilitation-treatment-center/ http://revver.com/watch/1150752 drug abuse rehab The Last Resort PA, Rehabilitation Treatment Center Call The Last Resort PA at (239) 494-6908. The Last Resort Pa's drug and alcohol rehab has an experienced staff, as well as superb facilities to help facilitate the recovery process of the Mind, Body and Spirit of those in need. Call The Last Resort PA at (239) 494-6908. The Last Resort Pa's drug and alcohol rehab has an experienced staff, as well as superb facilities to help facilitate the recovery process of the Mind, Body and Spirit of those in need. localvidsdotne localvidsdotne abuse addiction alcohol center dependency detox drug help recovery rehab substance treatment nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ The Last Resort PA, Rehabilitation Treatment Center Wed, 03 Sep 2008 19:54:59 -0800

Author: localvidsdotne
Added: Wed, 03 Sep 2008 19:54:59 -0800
Duration: 37

Call The Last Resort PA at (239) 494-8047. The Last Resort Pa's drug and alcohol rehab has an experienced staff, as well as superb facilities to help facilitate the recovery process of the Mind, Body and Spirit of those in need.

]]> abuseaddictionalcoholcenterdependencydetoxdrughelprecoveryrehabsubstancetreatment http://revver.com/video/1150823/the-last-resort-pa-rehabilitation-treatment-center/ http://revver.com/watch/1150823 The Last Resort PA, Rehabilitation Treatment Center Call The Last Resort PA at (239) 494-8047. The Last Resort Pa's drug and alcohol rehab has an experienced staff, as well as superb facilities to help facilitate the recovery process of the Mind, Body and Spirit of those in need. Call The Last Resort PA at (239) 494-8047. The Last Resort Pa's drug and alcohol rehab has an experienced staff, as well as superb facilities to help facilitate the recovery process of the Mind, Body and Spirit of those in need. localvidsdotne localvidsdotne abuse addiction alcohol center dependency detox drug help recovery rehab substance treatment nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/