Videos by masterjames Videos by masterjames http://revver.com/u/masterjames/ http://revver.com webmaster@revver.com Eating paper Wed, 08 Aug 2007 10:04:06 -0800

Author: masterjames
Added: Wed, 08 Aug 2007 10:04:06 -0800
Duration: 54

I may have won the national robotics competition, but before that, I was hungry. And they took too long bringing out the food.

]]> candycrapdeliciouseatingediblefoodinediblejackassnotpalablepaperretardedscrumptiousstupidsweettastyyummy http://revver.com/video/356117/eating-paper/ http://revver.com/watch/356117 Eating paper I may have won the national robotics competition, but before that, I was hungry. And they took too long bringing out the food. I may have won the national robotics competition, but before that, I was hungry. And they took too long bringing out the food. masterjames masterjames candy crap delicious eating edible food inedible jackass not palable paper retarded scrumptious stupid sweet tasty yummy nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Disrupting my Physics Exam Thu, 28 Jun 2007 16:43:08 -0800

Author: masterjames
Added: Thu, 28 Jun 2007 16:43:08 -0800
Duration: 97

After finishing my exam I felt it was time for some happy music to de-stress the class =)

]]> cheerfulcheeringexamexamsfinalfinalsfunfunnyhappinesshappyhilariousmephysicphysicsstresstake http://revver.com/video/316658/disrupting-my-physics-exam/ http://revver.com/watch/316658 Disrupting my Physics Exam After finishing my exam I felt it was time for some happy music to de-stress the class =) After finishing my exam I felt it was time for some happy music to de-stress the class =) Jamie Jamie cheerful cheering exam exams final finals fun funny happiness happy hilarious me physic physics stress take nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Sideflip at Awards Ceremony! Thu, 14 Jun 2007 12:43:06 -0800

Author: masterjames
Added: Thu, 14 Jun 2007 12:43:06 -0800
Duration: 43

After receiving my Gold medal for Skills Canada National Robotics, I did a quick sideflip off the stage! Not many people saw it because it was so casual/smooth!

]]> 1stawardscanadacoolgoldmedalnationalsoffplaceroboticssideflipsideflipsskillsstairstrickingwinners http://revver.com/video/301635/sideflip-at-awards-ceremony/ http://revver.com/watch/301635 Sideflip at Awards Ceremony! After receiving my Gold medal for Skills Canada National Robotics, I did a quick sideflip off the stage! Not many people saw it because it was so casual/smooth! After receiving my Gold medal for Skills Canada National Robotics, I did a quick sideflip off the stage! Not many people saw it because it was so casual/smooth! masterjames masterjames 1st awards canada cool gold medal nationals off place robotics sideflip sideflips skills stairs tricking winners nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Robot Car Drifting Thu, 14 Jun 2007 12:37:11 -0800

Author: masterjames
Added: Thu, 14 Jun 2007 12:37:11 -0800
Duration: 18

We put some graphite on the tires and started powersliding around the competition! We received 1st place, doubling almost the score of almost all other competitor robots.

]]> canadacooldriftdriftingdriftsfunnygoldmedalnationalspowerpowerslideroboticsskiddingskillsslidewinners http://revver.com/video/301634/robot-car-drifting/ http://revver.com/watch/301634 Robot Car Drifting We put some graphite on the tires and started powersliding around the competition! We received 1st place, doubling almost the score of almost all other competitor robots. We put some graphite on the tires and started powersliding around the competition! We received 1st place, doubling almost the score of almost all other competitor robots. masterjames masterjames canada cool drift drifting drifts funny gold medal nationals power powerslide robotics skidding skills slide winners nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Backflipping to Saskatoon! (part 1) Wed, 06 Jun 2007 08:43:07 -0800

Author: masterjames
Added: Wed, 06 Jun 2007 08:43:07 -0800
Duration: 70

Backflipping to Saskatoon! More stuff coming

]]> backbackflippingbacktuckbacktucksflippingflipsgymnasticssaskatoontrickingtumbling http://revver.com/video/292377/backflipping-to-saskatoon-part-1/ http://revver.com/watch/292377 Backflipping to Saskatoon! (part 1) Backflipping to Saskatoon! More stuff coming Backflipping to Saskatoon! More stuff coming masterjames masterjames back backflipping backtuck backtucks flipping flips gymnastics saskatoon tricking tumbling nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Falling off a bar Wed, 30 May 2007 15:43:22 -0800

Author: masterjames
Added: Wed, 30 May 2007 15:43:22 -0800
Duration: 6

AHH!

]]> 11-storyaccidentaccidentalbackflipdangerousdaredevildeathdyingfallfallingfellflightflipflippingfreerunningheighthighlayoutpainstorysufferingtrickingup http://revver.com/video/285684/falling-off-a-bar/ http://revver.com/watch/285684 Falling off a bar AHH! AHH! masterjames masterjames 1 1-story accident accidental backflip dangerous daredevil death dying fall falling fell flight flip flipping freerunning height high layout pain story suffering tricking up nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Sideflips! Wed, 30 May 2007 12:07:36 -0800

Author: masterjames
Added: Wed, 30 May 2007 12:07:36 -0800
Duration: 5

Me and Coops do a insync side flip!

]]> aircooldaredevilflightflipflippingflipzflyingfreerunninggymnasticsparkrotationsemisidesideflipstunttrickintrickingtuckxma http://revver.com/video/285458/sideflips/ http://revver.com/watch/285458 Sideflips! Me and Coops do a insync side flip! Me and Coops do a insync side flip! masterjames masterjames air cool daredevil flight flip flipping flipz flying freerunning gymnastics park rotation semi side sideflip stunt trickin tricking tuck xma nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Freerunning preview Thu, 24 May 2007 20:19:09 -0800

Author: masterjames
Added: Thu, 24 May 2007 20:19:09 -0800
Duration: 22

Watch as the pace steps up throughout the video!

]]> daredevilfreefreerunningparkourrunningskillsvaultingvaults http://revver.com/video/279005/freerunning-preview/ http://revver.com/watch/279005 Freerunning preview Watch as the pace steps up throughout the video! Watch as the pace steps up throughout the video! masterjames masterjames dare devil free freerunning parkour running skills vaulting vaults nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Randomness Mon, 21 May 2007 08:55:18 -0800

Author: masterjames
Added: Mon, 21 May 2007 08:55:18 -0800
Duration: 25

Bit of randomness after winning.

]]> bathroomscanadagayimmedalsnotroboticsskillsvictorywinningwootyayeahyeahh http://revver.com/video/275206/randomness/ http://revver.com/watch/275206 Randomness Bit of randomness after winning. Bit of randomness after winning. masterjames masterjames bathrooms canada gay im medals not robotics skills victory winning woot ya yeah yeahh nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Into the burkley room Mon, 21 May 2007 08:55:18 -0800

Author: masterjames
Added: Mon, 21 May 2007 08:55:18 -0800
Duration: 46

Yep

]]> burkleycanadadebriefinggoldmedalontarioownedroomskillsteamwinnerswon http://revver.com/video/275211/into-the-burkley-room/ http://revver.com/watch/275211 Into the burkley room Yep Yep masterjames masterjames burkley canada debriefing gold medal ontario owned room skills team winners won nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Skills Canada Robotics view from our robot Mon, 21 May 2007 08:55:18 -0800

Author: masterjames
Added: Mon, 21 May 2007 08:55:18 -0800
Duration: 167

We mounted a camera on our robot for one of the competitions - this is what the robot saw.

]]> canadadesignengineeringingenuitymechanicmechanicsrobotroboticsrobotsskillsskillscanadatechtechnology http://revver.com/video/275198/skills-canada-robotics-view-from-our-robot/ http://revver.com/watch/275198 Skills Canada Robotics view from our robot We mounted a camera on our robot for one of the competitions - this is what the robot saw. We mounted a camera on our robot for one of the competitions - this is what the robot saw. masterjames masterjames canada design engineering ingenuity mechanic mechanics robot robotics robots skills skillscanada tech technology nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Climbing in and out of my 2nd floor window Sun, 20 May 2007 14:34:10 -0800

Author: masterjames
Added: Sun, 20 May 2007 14:34:10 -0800
Duration: 81

Wee!

]]> boulderingclimbclimbinclimbingdangerousdaredaredevildevilfunnyrockscalescalingstupidwall http://revver.com/video/274414/climbing-in-and-out-of-my-2nd-floor-window/ http://revver.com/watch/274414 Climbing in and out of my 2nd floor window Wee! Wee! masterjames masterjames bouldering climb climbin climbing dangerous dare daredevil devil funny rock scale scaling stupid wall nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ A Short Time Remains - 1960's film commercial Wed, 09 May 2007 20:10:11 -0800

Author: masterjames
Added: Wed, 09 May 2007 20:10:11 -0800
Duration: 10

An old classic - A short time remains to make your way to the refreshments bar! Creative Commons License: Public Domain

]]> 19601960sadadvertadvertisementbarcommercialdrivefilmmoviesnackstheatretv http://revver.com/video/263919/a-short-time-remains-1960s-film-commercial/ http://revver.com/watch/263919 A Short Time Remains - 1960's film commercial An old classic - A short time remains to make your way to the refreshments bar! Creative Commons License: Public Domain An old classic - A short time remains to make your way to the refreshments bar! Creative Commons License: Public Domain masterjames masterjames 1960 1960s ad advert advertisement bar commercial drive film movie snacks theatre tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Lonelyboy69 E14 April 27 Sat, 28 Apr 2007 10:58:07 -0800

Author: masterjames
Added: Sat, 28 Apr 2007 10:58:07 -0800
Duration: 166

lonelyboy is back in a thrilling new episode with new plot twists

]]> lonelyboy69lonelyboy69lonelybo http://revver.com/video/250658/lonelyboy69-e14-april-27/ http://revver.com/watch/250658 Lonelyboy69 E14 April 27 lonelyboy is back in a thrilling new episode with new plot twists lonelyboy is back in a thrilling new episode with new plot twists masterjames masterjames lonelyboy69lonelyboy69lonelybo nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Smoke from fire Mon, 23 Apr 2007 23:01:06 -0800

Author: masterjames
Added: Mon, 23 Apr 2007 23:01:06 -0800
Duration: 13

Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage.

]]> ashashesblackburnedburningburnsbushbushfirefightersfirefirefightersfiremanfiresflamesgrassgreyinfernoquickrailrailroadroadsmokespreadingtrackwhitewood http://revver.com/video/244979/smoke-from-fire/ http://revver.com/watch/244979 Smoke from fire Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage. Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage. masterjames masterjames ash ashes black burned burning burns bush bushfire fighters fire firefighters fireman fires flames grass grey inferno quick rail railroad road smoke spreading track white wood nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Putting fire out Mon, 23 Apr 2007 23:01:06 -0800

Author: masterjames
Added: Mon, 23 Apr 2007 23:01:06 -0800
Duration: 11

Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage.

]]> ashashesburnedburningbushbushfirefightersfirefirefightersfiresflamesgrassinfernopouringquickrailrailroadroadsmokinsmokingsoaksoakedsoakingspreadingtrackwaterwateringwood http://revver.com/video/244982/putting-fire-out/ http://revver.com/watch/244982 Putting fire out Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage. Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage. masterjames masterjames ash ashes burned burning bush bushfire fighters fire firefighters fires flames grass inferno pouring quick rail railroad road smokin smoking soak soaked soaking spreading track water watering wood nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Watering fence to put embers out Mon, 23 Apr 2007 23:01:06 -0800

Author: masterjames
Added: Mon, 23 Apr 2007 23:01:06 -0800
Duration: 8

Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage.

]]> ashashesburnedburnsbushbushfireembersfencefightersfirefirefightersfiresflamesgrassinfernoquickrailrailroadsoakedsoakingspreadingtrackwaterwatering http://revver.com/video/244984/watering-fence-to-put-embers-out/ http://revver.com/watch/244984 Watering fence to put embers out Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage. Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage. masterjames masterjames ash ashes burned burns bush bushfire embers fence fighters fire firefighters fires flames grass inferno quick rail railroad soaked soaking spreading track water watering nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Firemen hauling hose Mon, 23 Apr 2007 22:49:05 -0800

Author: masterjames
Added: Mon, 23 Apr 2007 22:49:05 -0800
Duration: 34

Hose was too short and the fire was too isolated from roads, so the fireman had to keep running back for more hose attachments. Took over an hour to put it out. Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage.

]]> ashashesblackburnedburningburnsbushbushfirefightersfirefirefightersfiremanfiresflamesgrassgreyinfernoquickrailrailroadroadsmokespreadingtrackwhitewood http://revver.com/video/244966/firemen-hauling-hose/ http://revver.com/watch/244966 Firemen hauling hose Hose was too short and the fire was too isolated from roads, so the fireman had to keep running back for more hose attachments. Took over an hour to put it out. Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage. Hose was too short and the fire was too isolated from roads, so the fireman had to keep running back for more hose attachments. Took over an hour to put it out. Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage. masterjames masterjames ash ashes black burned burning burns bush bushfire fighters fire firefighters fireman fires flames grass grey inferno quick rail railroad road smoke spreading track white wood nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Fireman putting fire out Mon, 23 Apr 2007 22:49:05 -0800

Author: masterjames
Added: Mon, 23 Apr 2007 22:49:05 -0800
Duration: 20

Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage.

]]> ashashesburnedburningbushbushfirefightersfirefirefightersfiremanfiresflamesgrassinfernooutputtingquickrailrailroadroadspreadingtrackwood http://revver.com/video/244968/fireman-putting-fire-out/ http://revver.com/watch/244968 Fireman putting fire out Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage. Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage. masterjames masterjames ash ashes burned burning bush bushfire fighters fire firefighters fireman fires flames grass inferno out putting quick rail railroad road spreading track wood nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Firemen putting fire out Mon, 23 Apr 2007 22:49:05 -0800

Author: masterjames
Added: Mon, 23 Apr 2007 22:49:05 -0800
Duration: 38

Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage.

]]> ashashesblackburnedburningburnsbushbushfirefightersfirefirefightersfiremanfiresflamesgrassgreyinfernoquickrailrailroadroadsmokespreadingtrackwhitewood http://revver.com/video/244969/firemen-putting-fire-out/ http://revver.com/watch/244969 Firemen putting fire out Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage. Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage. masterjames masterjames ash ashes black burned burning burns bush bushfire fighters fire firefighters fireman fires flames grass grey inferno quick rail railroad road smoke spreading track white wood nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Quick spreading fire Mon, 23 Apr 2007 21:10:13 -0800

Author: masterjames
Added: Mon, 23 Apr 2007 21:10:13 -0800
Duration: 27

Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage.

]]> ashashesblackburnedburningburnsbushbushfirefightersfirefirefightersfiremanfiresflamesgrassgreyinfernoquickrailrailroadroadsmokespreadingtrackwhitewood http://revver.com/video/244964/quick-spreading-fire/ http://revver.com/watch/244964 Quick spreading fire Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage. Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage. masterjames masterjames ash ashes black burned burning burns bush bushfire fighters fire firefighters fireman fires flames grass grey inferno quick rail railroad road smoke spreading track white wood nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Dark smoke from grass fire Mon, 23 Apr 2007 20:52:06 -0800

Author: masterjames
Added: Mon, 23 Apr 2007 20:52:06 -0800
Duration: 12

Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage. bush grass fire fighters bushfire firefighters flames quick spreading fires burned ashes ash inferno railroad track rail road burning wood burns white grey black smoke

]]> ashashesblackburnedburningburnsbushbushfirectvfightersfirefirefightersfiresflamesgrassgreyinfernonewspyropyromaniacquickrailrailroadroadsmokespreadingtrackwhitewood http://revver.com/video/244911/dark-smoke-from-grass-fire/ http://revver.com/watch/244911 Dark smoke from grass fire Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage. bush grass fire fighters bushfire firefighters flames quick spreading fires burned ashes ash inferno railroad track rail road burning wood burns white grey black smoke Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage. bush grass fire fighters bushfire firefighters flames quick spreading fires burned ashes ash inferno railroad track rail road burning wood burns white grey black smoke masterjames masterjames ash ashes black burned burning burns bush bushfire ctv fighters fire firefighters fires flames grass grey inferno news pyro pyromaniac quick rail railroad road smoke spreading track white wood nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Fast spreading grass fire - firemans hose too short Mon, 23 Apr 2007 20:52:06 -0800

Author: masterjames
Added: Mon, 23 Apr 2007 20:52:06 -0800
Duration: 18

Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage.

]]> ashashesblackburnedburningburnsbushbushfirefightersfirefirefightersfiremanfiresflamesgrassgreyinfernomanquickrailrailroadroadsmokespreadingtrackwhitewood http://revver.com/video/244914/fast-spreading-grass-fire-firemans-hose-too-short/ http://revver.com/watch/244914 Fast spreading grass fire - firemans hose too short Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage. Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage. masterjames masterjames ash ashes black burned burning burns bush bushfire fighters fire firefighters fireman fires flames grass grey inferno man quick rail railroad road smoke spreading track white wood nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Firefighter climbs over fence Mon, 23 Apr 2007 20:52:06 -0800

Author: masterjames
Added: Mon, 23 Apr 2007 20:52:06 -0800
Duration: 11

Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage.

]]> ashashesblackburnedburningburnsbushbushfirefightersfirefirefightersfiremanfiresflamesgrassgreyinfernomanquickrailrailroadroadsmokespreadingtrackwhitewood http://revver.com/video/244915/firefighter-climbs-over-fence/ http://revver.com/watch/244915 Firefighter climbs over fence Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage. Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage. masterjames masterjames ash ashes black burned burning burns bush bushfire fighters fire firefighters fireman fires flames grass grey inferno man quick rail railroad road smoke spreading track white wood nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Clip of grass inferno fire Mon, 23 Apr 2007 20:52:06 -0800

Author: masterjames
Added: Mon, 23 Apr 2007 20:52:06 -0800
Duration: 5

Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage.

]]> ashashesblackburnedburningburnsbushbushfirefightersfirefirefightersfiremanfiresflamesgrassgreyinfernoquickrailrailroadroadsmokespreadingtrackwhitewood http://revver.com/video/244916/clip-of-grass-inferno-fire/ http://revver.com/watch/244916 Clip of grass inferno fire Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage. Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage. masterjames masterjames ash ashes black burned burning burns bush bushfire fighters fire firefighters fireman fires flames grass grey inferno quick rail railroad road smoke spreading track white wood nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Big grass fire Mon, 23 Apr 2007 20:52:06 -0800

Author: masterjames
Added: Mon, 23 Apr 2007 20:52:06 -0800
Duration: 5

Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage.

]]> ashashesblackburnedburningburnsbushbushfirefightersfirefirefightersfiremanfiresflamesgrassgreyinfernoquickrailrailroadroadsmokespreadingtrackwhitewood http://revver.com/video/244917/big-grass-fire/ http://revver.com/watch/244917 Big grass fire Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage. Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage. masterjames masterjames ash ashes black burned burning burns bush bushfire fighters fire firefighters fireman fires flames grass grey inferno quick rail railroad road smoke spreading track white wood nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Fireman hops fence to put out fire Mon, 23 Apr 2007 20:52:06 -0800

Author: masterjames
Added: Mon, 23 Apr 2007 20:52:06 -0800
Duration: 10

PARKOUR GATE VAULT!!! OMG Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage.

]]> ashashesblackburnedburningburnsbushbushfirefightersfirefirefightersfiremanfiresflamesgrassgreyinfernoquickrailrailroadroadsmokespreadingtrackwhitewood http://revver.com/video/244927/fireman-hops-fence-to-put-out-fire/ http://revver.com/watch/244927 Fireman hops fence to put out fire PARKOUR GATE VAULT!!! OMG Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage. PARKOUR GATE VAULT!!! OMG Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. Used on CTV news Sunday April 22, 2007 after I contacted them about capturing the footage. masterjames masterjames ash ashes black burned burning burns bush bushfire fighters fire firefighters fireman fires flames grass grey inferno quick rail railroad road smoke spreading track white wood nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Grass fire lots of smoke Sun, 22 Apr 2007 17:19:05 -0800

Author: masterjames
Added: Sun, 22 Apr 2007 17:19:05 -0800
Duration: 33

Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. bush grass fire fighters bushfire firefighters flames quick spreading fires burned ashes ash inferno railroad track rail road burning wood burns white grey black smoke

]]> ashashesblackburnedburningburnsbushbushfirefightersfirefirefightersfiresflamesgrassgreyinfernoquickrailrailroadroadsmokespreadingtrackwhitewood http://revver.com/video/243618/grass-fire-lots-of-smoke/ http://revver.com/watch/243618 Grass fire lots of smoke Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. bush grass fire fighters bushfire firefighters flames quick spreading fires burned ashes ash inferno railroad track rail road burning wood burns white grey black smoke Here's another clip from the grass fire on April 22, 2007 between university avenue and fischer hallman along the railroad tracks. bush grass fire fighters bushfire firefighters flames quick spreading fires burned ashes ash inferno railroad track rail road burning wood burns white grey black smoke masterjames masterjames ash ashes black burned burning burns bush bushfire fighters fire firefighters fires flames grass grey inferno quick rail railroad road smoke spreading track white wood nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Double leg bail! Wed, 18 Apr 2007 22:13:06 -0800

Author: masterjames
Added: Wed, 18 Apr 2007 22:13:06 -0800
Duration: 10

Haha what a crash!

]]> bailbuildingcrashcrazydaredevildeathlydoubledoublelegfailfailurefallfallenfellflippingfreerunninginsanelegoffpainshedsideflipskillsskillzsoretricking http://revver.com/video/239296/double-leg-bail/ http://revver.com/watch/239296 Double leg bail! Haha what a crash! Haha what a crash! masterjames masterjames bail building crash crazy daredevil deathly double doubleleg fail failure fall fallen fell flipping freerunning insane leg off pain shed sideflip skills skillz sore tricking nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ SMPTE Colour Bars Clip Wed, 18 Apr 2007 22:13:06 -0800

Author: masterjames
Added: Wed, 18 Apr 2007 22:13:06 -0800
Duration: 4

Made this up in Adobe Premiere Pro. Used at the beginning of videos as a standard so broadcasters can tell how the signal has been distorted and what must be done in order to return it to its initial form.

]]> barsclipcolorcolourcoloursntscsmptetone http://revver.com/video/239300/smpte-colour-bars-clip/ http://revver.com/watch/239300 SMPTE Colour Bars Clip Made this up in Adobe Premiere Pro. Used at the beginning of videos as a standard so broadcasters can tell how the signal has been distorted and what must be done in order to return it to its initial form. Made this up in Adobe Premiere Pro. Used at the beginning of videos as a standard so broadcasters can tell how the signal has been distorted and what must be done in order to return it to its initial form. masterjames masterjames bars clip color colour colours ntsc smpte tone nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Coop's Welcome Back Into Tricking Wed, 18 Apr 2007 22:02:40 -0800

Author: masterjames
Added: Wed, 18 Apr 2007 22:02:40 -0800
Duration: 144

He hasn't tricked in ages! Here are his first attempts at flipping again!

]]> backbackflipfirstflipflippingfreshgrassnewoutsidetimetrickintrickingtryunexperiencedwelcome http://revver.com/video/239288/coops-welcome-back-into-tricking/ http://revver.com/watch/239288 Coop's Welcome Back Into Tricking He hasn't tricked in ages! Here are his first attempts at flipping again! He hasn't tricked in ages! Here are his first attempts at flipping again! masterjames masterjames back backflip first flip flipping fresh grass new outside time trickin tricking try unexperienced welcome nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Double leg off building Wed, 18 Apr 2007 22:02:40 -0800

Author: masterjames
Added: Wed, 18 Apr 2007 22:02:40 -0800
Duration: 11

Wee!

]]> buildingcrazydaredevildeathlydoubledoublelegflippingfreerunninginsanelegoffshedsideflipskillsskillztricking http://revver.com/video/239291/double-leg-off-building/ http://revver.com/watch/239291 Double leg off building Wee! Wee! masterjames masterjames building crazy daredevil deathly double doubleleg flipping freerunning insane leg off shed sideflip skills skillz tricking nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Happy Mother's Day Wed, 18 Apr 2007 21:22:07 -0800

Author: masterjames
Added: Wed, 18 Apr 2007 21:22:07 -0800
Duration: 20

My Mother's day video submission.

]]> artisticbloomingcelebrationdayeveningflowaflowerflowersholidayinterestinglovemaamammamamommommymothermothersmummummyoparealreal-timerevverrfsrfs-momrfsmomtimetulip http://revver.com/video/239262/happy-mothers-day/ http://revver.com/watch/239262 Happy Mother's Day My Mother's day video submission. My Mother's day video submission. masterjames masterjames artistic blooming celebration day evening flowa flower flowers holiday interesting love maa mam mama mom mommy mother mothers mum mummy opa real real-time revver rfs rfs-mom rfsmom time tulip nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Quick bicep flex Sat, 14 Apr 2007 21:33:24 -0800

Author: masterjames
Added: Sat, 14 Apr 2007 21:33:24 -0800
Duration: 17

ohhh yeahhhh

]]> amazingarmbeautifulbicepbodybuilderfagfhagflexflexinggaygeyguyhomohomosexualmanmusclemusclesmuscularnakednekidoffpowerfulsexyshowingskinskinnystrengthstrong http://revver.com/video/235175/quick-bicep-flex/ http://revver.com/watch/235175 Quick bicep flex ohhh yeahhhh ohhh yeahhhh masterjames masterjames amazing arm beautiful bicep body builder fag fhag flex flexing gay gey guy homo homosexual man muscle muscles muscular naked nekid off powerful sexy showing skin skinny strength strong nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Another quick bicep flex Sat, 14 Apr 2007 21:33:24 -0800

Author: masterjames
Added: Sat, 14 Apr 2007 21:33:24 -0800
Duration: 14

just a quickie

]]> amazingarmbeautifulbicepbodybuilderfagfhagflexflexinggaygeyguyhomohomosexualmanmusclemusclesmuscularnakednekidoffpowerfulsexyshowingskinskinnystrengthstrong http://revver.com/video/235183/another-quick-bicep-flex/ http://revver.com/watch/235183 Another quick bicep flex just a quickie just a quickie masterjames masterjames amazing arm beautiful bicep body builder fag fhag flex flexing gay gey guy homo homosexual man muscle muscles muscular naked nekid off powerful sexy showing skin skinny strength strong nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Funny high pitched voice Fri, 13 Apr 2007 21:03:41 -0800

Author: masterjames
Added: Fri, 13 Apr 2007 21:03:41 -0800
Duration: 13

Aha Mark's funny... this was from a clip from a school Macbeth production

]]> awesomefunnyhighhilariousjokeesjokesmacbethpitchedthatsthatsjokesvoiceweird http://revver.com/video/234317/funny-high-pitched-voice/ http://revver.com/watch/234317 Funny high pitched voice Aha Mark's funny... this was from a clip from a school Macbeth production Aha Mark's funny... this was from a clip from a school Macbeth production Mark Mark awesome funny high hilarious jokees jokes macbeth pitched thats thatsjokes voice weird nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mark funny again Fri, 13 Apr 2007 20:45:32 -0800

Author: masterjames
Added: Fri, 13 Apr 2007 20:45:32 -0800
Duration: 6

School Macbeth production - sped up 120%

]]> awesomebinbinladenfunnyhighhilariousjokeesjokesladenmacbethosamaosamabinladenpitchedthatsthatsjokesvoiceweird http://revver.com/video/234319/mark-funny-again/ http://revver.com/watch/234319 Mark funny again School Macbeth production - sped up 120% School Macbeth production - sped up 120% Mark Mark awesome bin binladen funny high hilarious jokees jokes laden macbeth osama osamabinladen pitched thats thatsjokes voice weird nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Lonelyboy69 E07.5 Mar 10 Tue, 10 Apr 2007 21:49:07 -0800

Author: masterjames
Added: Tue, 10 Apr 2007 21:49:07 -0800
Duration: 46

hey guys i have to switch revver accounts so now all my new episodes will be posted to http://one.revver.com/account/show/lonelyboy69

]]> 69aloneboycolddailydepresseddepressingemoemotionemotionalfriendlessfriendslifelonelylonelyboylonelyboy69lonerlonesomenopitifulrawsadsuicidalsuicideupdatedupdatesvlogwasteworld http://revver.com/video/231388/lonelyboy69-e075-mar-10/ http://revver.com/watch/231388 Lonelyboy69 E07.5 Mar 10 hey guys i have to switch revver accounts so now all my new episodes will be posted to http://one.revver.com/account/show/lonelyboy69 hey guys i have to switch revver accounts so now all my new episodes will be posted to http://one.revver.com/account/show/lonelyboy69 masterjames masterjames 69 alone boy cold daily depressed depressing emo emotion emotional friendless friends life lonely lonelyboy lonelyboy69 loner lonesome no pitiful raw sad suicidal suicide updated updates vlog waste world nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Lonelyboy69 E07 Mar 10 Tue, 10 Apr 2007 21:04:06 -0800

Author: masterjames
Added: Tue, 10 Apr 2007 21:04:06 -0800
Duration: 58

Battery barely hanging in there...

]]> 69aloneboycolddailydepresseddepressingemoemotionemotionalfriendlessfriendslifelonelylonelyboylonelyboy69lonerlonesomenopitifulrawsadsuicidalsuicideupdatedupdatesvlogwasteworld http://revver.com/video/231281/lonelyboy69-e07-mar-10/ http://revver.com/watch/231281 Lonelyboy69 E07 Mar 10 Battery barely hanging in there... Battery barely hanging in there... masterjames masterjames 69 alone boy cold daily depressed depressing emo emotion emotional friendless friends life lonely lonelyboy lonelyboy69 loner lonesome no pitiful raw sad suicidal suicide updated updates vlog waste world nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Lonelyboy69 E06 Mar 9 Mon, 09 Apr 2007 11:40:16 -0800

Author: masterjames
Added: Mon, 09 Apr 2007 11:40:16 -0800
Duration: 76

no electricity :(

]]> 69aloneboycoldcryingdeathsemoemotionemotionallonelylonelyboy69sadsadnessuicideworld http://revver.com/video/229891/lonelyboy69-e06-mar-9/ http://revver.com/watch/229891 Lonelyboy69 E06 Mar 9 no electricity :( no electricity :( masterjames masterjames 69 alone boy cold crying deaths emo emotion emotional lonely lonelyboy69 sad sadness uicide world nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Lonelyboy69 E05 Mar 8 Sun, 08 Apr 2007 20:46:06 -0800

Author: masterjames
Added: Sun, 08 Apr 2007 20:46:06 -0800
Duration: 141

holidays suck. period.

]]> aloneboycoldcryingdeathemoemotionemotionallonelylonelyboy69sadsadnesssuicideworld http://revver.com/video/229318/lonelyboy69-e05-mar-8/ http://revver.com/watch/229318 Lonelyboy69 E05 Mar 8 holidays suck. period. holidays suck. period. masterjames masterjames alone boy cold crying death emo emotion emotional lonely lonelyboy69 sad sadness suicide world nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Cleanly breaking the bottom off a beer bottle with my hand Sat, 07 Apr 2007 21:49:09 -0800

Author: masterjames
Added: Sat, 07 Apr 2007 21:49:09 -0800
Duration: 31

I can cleanly break off the bottom of a beer bottle using only my hands and a cup of water. NO BEER WAS HARMED IN THE CREATION OF THIS VIDEO! Water was used.

]]> beerbottlebottombreakbreakingcoolcrackexplodefuninsaneinterestingmagicneatpartypartytrickpyschoshatterskillfulsmashtricktricky http://revver.com/video/228554/cleanly-breaking-the-bottom-off-a-beer-bottle-with-my-hand/ http://revver.com/watch/228554 Cleanly breaking the bottom off a beer bottle with my hand I can cleanly break off the bottom of a beer bottle using only my hands and a cup of water. NO BEER WAS HARMED IN THE CREATION OF THIS VIDEO! Water was used. I can cleanly break off the bottom of a beer bottle using only my hands and a cup of water. NO BEER WAS HARMED IN THE CREATION OF THIS VIDEO! Water was used. Master James Master James beer bottle bottom break breaking cool crack explode fun insane interesting magic neat party partytrick pyscho shatter skillful smash trick tricky nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Breaking a Corona with bare hands Sat, 07 Apr 2007 21:49:09 -0800

Author: masterjames
Added: Sat, 07 Apr 2007 21:49:09 -0800
Duration: 14

One hit KO! Listen to the commentary haha! NO BEER WAS HARMED IN THE CREATION OF THIS VIDEO! Water was used.

]]> beerbottlebottombreakbreakingcoolcrackexplodefuninterestingmagicneatpartypartytrickshattersmashtrick http://revver.com/video/228568/breaking-a-corona-with-bare-hands/ http://revver.com/watch/228568 Breaking a Corona with bare hands One hit KO! Listen to the commentary haha! NO BEER WAS HARMED IN THE CREATION OF THIS VIDEO! Water was used. One hit KO! Listen to the commentary haha! NO BEER WAS HARMED IN THE CREATION OF THIS VIDEO! Water was used. Master James Master James beer bottle bottom break breaking cool crack explode fun interesting magic neat party partytrick shatter smash trick nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Breaking the bottom off a 26er of Bacardi Sat, 07 Apr 2007 21:28:30 -0800

Author: masterjames
Added: Sat, 07 Apr 2007 21:28:30 -0800
Duration: 59

I had seen this trick done on beer bottles and other small bottles but I have never seen it done on a 750ml bottle. Took me a few hits but I managed to pop the bottom off nice and cleanly! No alcohol was harmed in the creation of this video. Water was used instead. Also watch: http://one.revver.com/watch/228554/flv/affiliate/39273 and http://one.revver.com/watch/228568/flv/affiliate/39273

]]> 26er750mlalcoholbacardiboozebottlebottlesbreakingbrokencoolglassimpressivemagicmagicianmagictrickpartypartytricksmashsmashedstrongtrickwater http://revver.com/video/228490/breaking-the-bottom-off-a-26er-of-bacardi/ http://revver.com/watch/228490 Breaking the bottom off a 26er of Bacardi I had seen this trick done on beer bottles and other small bottles but I have never seen it done on a 750ml bottle. Took me a few hits but I managed to pop the bottom off nice and cleanly! No alcohol was harmed in the creation of this video. Water was used instead. Also watch: http://one.revver.com/watch/228554/flv/affiliate/39273 and http://one.revver.com/watch/228568/flv/affiliate/39273 I had seen this trick done on beer bottles and other small bottles but I have never seen it done on a 750ml bottle. Took me a few hits but I managed to pop the bottom off nice and cleanly! No alcohol was harmed in the creation of this video. Water was used instead. Also watch: http://one.revver.com/watch/228554/flv/affiliate/39273 and http://one.revver.com/watch/228568/flv/affiliate/39273 Master James Master James 26er 750ml alcohol bacardi booze bottle bottles breaking broken cool glass impressive magic magician magictrick party partytrick smash smashed strong trick water nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Lonelyboy69 E04 Mar 7 Sat, 07 Apr 2007 21:28:30 -0800

Author: masterjames
Added: Sat, 07 Apr 2007 21:28:30 -0800
Duration: 123

life sucks. people love to taunt me. i f*ckin hate it. why does everyone try and make me mad? what did i ever do!

]]> 69aloneboycoldcryingdeathemoemotionemotionallonelylonelyboy69sadsadnesssuicideworld http://revver.com/video/228523/lonelyboy69-e04-mar-7/ http://revver.com/watch/228523 Lonelyboy69 E04 Mar 7 life sucks. people love to taunt me. i f*ckin hate it. why does everyone try and make me mad? what did i ever do! life sucks. people love to taunt me. i f*ckin hate it. why does everyone try and make me mad? what did i ever do! masterjames masterjames 69 alone boy cold crying death emo emotion emotional lonely lonelyboy69 sad sadness suicide world nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Lonelyboy69 E03 Mar 6 Fri, 06 Apr 2007 12:31:21 -0800

Author: masterjames
Added: Fri, 06 Apr 2007 12:31:21 -0800
Duration: 104

its good friday... i don't see whats so good about it though :*-(

]]> 69aloneboycoldcryingdeathemoemotionemotionallonelylonelyboy69sadsadnesssuicideworld http://revver.com/video/227377/lonelyboy69-e03-mar-6/ http://revver.com/watch/227377 Lonelyboy69 E03 Mar 6 its good friday... i don't see whats so good about it though :*-( its good friday... i don't see whats so good about it though :*-( masterjames masterjames 69 alone boy cold crying death emo emotion emotional lonely lonelyboy69 sad sadness suicide world nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ A Degree Of Learning Ad (1961) Fri, 06 Apr 2007 11:49:07 -0800

Author: masterjames
Added: Fri, 06 Apr 2007 11:49:07 -0800
Duration: 8

A classic! This tv commercial was released as public domain under the Creative Commons license. Feel free to share this video with anyone.

]]> 19601960s1961adcommercialcooldegreeseducationfunnyinterestinglearningoldpastrelicsixties http://revver.com/video/226925/a-degree-of-learning-ad-1961/ http://revver.com/watch/226925 A Degree Of Learning Ad (1961) A classic! This tv commercial was released as public domain under the Creative Commons license. Feel free to share this video with anyone. A classic! This tv commercial was released as public domain under the Creative Commons license. Feel free to share this video with anyone. masterjames masterjames 1960 1960s 1961 ad commercial cool degrees education funny interesting learning old past relic sixties nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Lonelyboy69 E02 Mar 6 Fri, 06 Apr 2007 03:04:18 -0800

Author: masterjames
Added: Fri, 06 Apr 2007 03:04:18 -0800
Duration: 223

It's 3:55AM and I can't sleep. Neither can I talk.

]]> 69aloneboycoldcryingdeathemoemotionemotionallonelylonelyboy69sadsadnesssuicideworld http://revver.com/video/226986/lonelyboy69-e02-mar-6/ http://revver.com/watch/226986 Lonelyboy69 E02 Mar 6 It's 3:55AM and I can't sleep. Neither can I talk. It's 3:55AM and I can't sleep. Neither can I talk. masterjames masterjames 69 alone boy cold crying death emo emotion emotional lonely lonelyboy69 sad sadness suicide world nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Lonelyboy69 intro Thu, 05 Apr 2007 20:34:14 -0800

Author: masterjames
Added: Thu, 05 Apr 2007 20:34:14 -0800
Duration: 33

Starting up a video diary. Listen to my sadness. :-(

]]> 69aloneboycoldcryingdeathemoemotionemotionallonelylonelyboy69sadsadnesssuicideworld http://revver.com/video/226708/lonelyboy69-intro/ http://revver.com/watch/226708 Lonelyboy69 intro Starting up a video diary. Listen to my sadness. :-( Starting up a video diary. Listen to my sadness. :-( masterjames masterjames 69 alone boy cold crying death emo emotion emotional lonely lonelyboy69 sad sadness suicide world nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Lonelyboy69 E01 Mar 5 Thu, 05 Apr 2007 20:34:14 -0800

Author: masterjames
Added: Thu, 05 Apr 2007 20:34:14 -0800
Duration: 71

first entry. it sucks. life sucks. whats the point?

]]> 69aloneboycoldcryingdeathemoemotionemotionallonelylonelyboy69sadsadnesssuicideworld http://revver.com/video/226718/lonelyboy69-e01-mar-5/ http://revver.com/watch/226718 Lonelyboy69 E01 Mar 5 first entry. it sucks. life sucks. whats the point? first entry. it sucks. life sucks. whats the point? masterjames masterjames 69 alone boy cold crying death emo emotion emotional lonely lonelyboy69 sad sadness suicide world nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ 1960's Milk Ad Thu, 05 Apr 2007 06:25:18 -0800

Author: masterjames
Added: Thu, 05 Apr 2007 06:25:18 -0800
Duration: 12

The most popular beverage in America. Video under Creative Commons license: Public Domain

]]> 19601960sadcommercialcoolcowcowsfunnyinterestingmilkoldpastrelicsixties http://revver.com/video/226171/1960s-milk-ad/ http://revver.com/watch/226171 1960's Milk Ad The most popular beverage in America. Video under Creative Commons license: Public Domain The most popular beverage in America. Video under Creative Commons license: Public Domain masterjames masterjames 1960 1960s ad commercial cool cow cows funny interesting milk old past relic sixties nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ First attempt at special fx editing Wed, 04 Apr 2007 23:43:15 -0800

Author: masterjames
Added: Wed, 04 Apr 2007 23:43:15 -0800
Duration: 51

WOW! haha! I had long hair back then... and lightning fingers. =D

]]> adobecooleditingeffectselectricalelectricityfingerslightningpremiererotoscopingspecialspecialfxvideozap http://revver.com/video/225955/first-attempt-at-special-fx-editing/ http://revver.com/watch/225955 First attempt at special fx editing WOW! haha! I had long hair back then... and lightning fingers. =D WOW! haha! I had long hair back then... and lightning fingers. =D masterjames masterjames adobe cool editing effects electrical electricity fingers lightning premiere rotoscoping special specialfx video zap nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Real-time blooming flowers Wed, 04 Apr 2007 23:22:07 -0800

Author: masterjames
Added: Wed, 04 Apr 2007 23:22:07 -0800
Duration: 249

These flowers bloom in the evening. This was recorded in real-time using my camcorder - it is not stop motion or sped up.Song by Freeplay music: "Flash Pipe" Please visit www.gardenhumour.com as this flower is from it

]]> artbeautifulbloombloomingcoolcrazyeveningfloraflowerfloweringforestgardenintelligentinterestingintriugingmodernplantplantstulip http://revver.com/video/225921/real-time-blooming-flowers/ http://revver.com/watch/225921 Real-time blooming flowers These flowers bloom in the evening. This was recorded in real-time using my camcorder - it is not stop motion or sped up.Song by Freeplay music: "Flash Pipe" Please visit www.gardenhumour.com as this flower is from it These flowers bloom in the evening. This was recorded in real-time using my camcorder - it is not stop motion or sped up.Song by Freeplay music: "Flash Pipe" Please visit www.gardenhumour.com as this flower is from it Freeplay music: Flashpipe Freeplay music: Flashpipe art beautiful bloom blooming cool crazy evening flora flower flowering forest garden intelligent interesting intriuging modern plant plants tulip nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ More various gym footage Wed, 04 Apr 2007 23:07:10 -0800

Author: masterjames
Added: Wed, 04 Apr 2007 23:07:10 -0800
Duration: 339

more!

]]> climbingclipscoolcrazyflipperflippinggymgymnasticsmadskillsmadskillzmonkeyninjarandomrussiantrickingtumblingurbanurbanninja http://revver.com/video/225383/more-various-gym-footage/ http://revver.com/watch/225383 More various gym footage more! more! masterjames masterjames climbing clips cool crazy flipper flipping gym gymnastics madskills madskillz monkey ninja random russian tricking tumbling urban urbanninja nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Deep Waters rowing experience Wed, 04 Apr 2007 22:52:07 -0800

Author: masterjames
Added: Wed, 04 Apr 2007 22:52:07 -0800
Duration: 77

This was scary as hell. The water was really deep.

]]> boatboatingdeepfunnyhilariouspouringrainrowingswimmingwaterwatersweird http://revver.com/video/225358/deep-waters-rowing-experience/ http://revver.com/watch/225358 Deep Waters rowing experience This was scary as hell. The water was really deep. This was scary as hell. The water was really deep. Coops Coops boat boating deep funny hilarious pouring rain rowing swimming water waters weird nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Gym footage! Wed, 04 Apr 2007 22:43:18 -0800

Author: masterjames
Added: Wed, 04 Apr 2007 22:43:18 -0800
Duration: 79

Just a whole bunch of tricking footage at the gym from last year!

]]> climbingclipscoolcrazyflipperflippinggymgymnasticsmadskillsmadskillzmonkeyninjarandomrussiantrickingtumblingurbanurbanninja http://revver.com/video/225380/gym-footage/ http://revver.com/watch/225380 Gym footage! Just a whole bunch of tricking footage at the gym from last year! Just a whole bunch of tricking footage at the gym from last year! masterjames masterjames climbing clips cool crazy flipper flipping gym gymnastics madskills madskillz monkey ninja random russian tricking tumbling urban urbanninja nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Tricking outside on the grass Wed, 04 Apr 2007 14:10:15 -0800

Author: masterjames
Added: Wed, 04 Apr 2007 14:10:15 -0800
Duration: 89

To the midi theme song of Indiana Jones!!!

]]> 540backflipflipflippingfrontflipgrasskickoutsidetornadotrickintricking http://revver.com/video/225374/tricking-outside-on-the-grass/ http://revver.com/watch/225374 Tricking outside on the grass To the midi theme song of Indiana Jones!!! To the midi theme song of Indiana Jones!!! masterjames masterjames 540 backflip flip flipping frontflip grass kick outside tornado trickin tricking nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Shawn's first backflip outside Wed, 04 Apr 2007 11:55:11 -0800

Author: masterjames
Added: Wed, 04 Apr 2007 11:55:11 -0800
Duration: 23

His first ones! He came to call on me after doing one at the bus stop and we filmed these!

]]> backbackflipeverfirstfliplandedoutsidestickstucksucceedsuccess http://revver.com/video/225377/shawns-first-backflip-outside/ http://revver.com/watch/225377 Shawn's first backflip outside His first ones! He came to call on me after doing one at the bus stop and we filmed these! His first ones! He came to call on me after doing one at the bus stop and we filmed these! Shawn Shawn back backflip ever first flip landed outside stick stuck succeed success nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Introducing... HELLRAISER HOODY! Wed, 04 Apr 2007 00:19:07 -0800

Author: masterjames
Added: Wed, 04 Apr 2007 00:19:07 -0800
Duration: 8

Isn't this design dope!? it is siiiiiick!

]]> badassclothingdesigndesignseshevolutionevolutionstopsherehellraiserherepimpingstopst-shirt http://revver.com/video/225035/introducing-hellraiser-hoody/ http://revver.com/watch/225035 Introducing... HELLRAISER HOODY! Isn't this design dope!? it is siiiiiick! Isn't this design dope!? it is siiiiiick! masterjames masterjames badass clothing design designs esh evolution evolutionstopshere hellraiser here pimping stops t-shirt nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ The walk home... Journey complete Wed, 04 Apr 2007 00:19:07 -0800

Author: masterjames
Added: Wed, 04 Apr 2007 00:19:07 -0800
Duration: 18

Woot!

]]> completecompletodoneendedendingfinishedhomeitsjourneyoverwalking http://revver.com/video/225037/the-walk-home-journey-complete/ http://revver.com/watch/225037 The walk home... Journey complete Woot! Woot! masterjames masterjames complete completo done ended ending finished home its journey over walking nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Carrying a cardboard box Wed, 04 Apr 2007 00:13:10 -0800

Author: masterjames
Added: Wed, 04 Apr 2007 00:13:10 -0800
Duration: 13

What evers inside!?

]]> boxclothingeshevolutionstopsheregearpackagepostalservice http://revver.com/video/225024/carrying-a-cardboard-box/ http://revver.com/watch/225024 Carrying a cardboard box What evers inside!? What evers inside!? masterjames masterjames box clothing esh evolutionstopshere gear package postal service nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ What? Wed, 04 Apr 2007 00:13:10 -0800

Author: masterjames
Added: Wed, 04 Apr 2007 00:13:10 -0800
Duration: 25

I dunno what's happening... figure it out yourself

]]> dontknowstrangeweirdweirdnesswhackwhattwhattt http://revver.com/video/225025/what/ http://revver.com/watch/225025 What? I dunno what's happening... figure it out yourself I dunno what's happening... figure it out yourself masterjames masterjames dont know strange weird weirdness whack whatt whattt nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Approaching of the plaza Wed, 04 Apr 2007 00:13:10 -0800

Author: masterjames
Added: Wed, 04 Apr 2007 00:13:10 -0800
Duration: 23

I'M FINALLY HERE! YAY! now to pick up hellraiser clothes

]]> coolendjourneyplazawalking http://revver.com/video/225022/approaching-of-the-plaza/ http://revver.com/watch/225022 Approaching of the plaza I'M FINALLY HERE! YAY! now to pick up hellraiser clothes I'M FINALLY HERE! YAY! now to pick up hellraiser clothes masterjames masterjames cool end journey plaza walking nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Hittin the bank Wed, 04 Apr 2007 00:04:14 -0800

Author: masterjames
Added: Wed, 04 Apr 2007 00:04:14 -0800
Duration: 20

GONNA ROB IT! Haha just kidding.

]]> alleybackbankingcanada http://revver.com/video/225020/hittin-the-bank/ http://revver.com/watch/225020 Hittin the bank GONNA ROB IT! Haha just kidding. GONNA ROB IT! Haha just kidding. masterjames masterjames alley back banking canada nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Backflip attempt #1 Tue, 03 Apr 2007 23:52:10 -0800

Author: masterjames
Added: Tue, 03 Apr 2007 23:52:10 -0800
Duration: 72

Too wobbly. :-(

]]> backbackflipfailfailedfailingfailurefencefliphorriblelifepitifulwobbly http://revver.com/video/224983/backflip-attempt-1/ http://revver.com/watch/224983 Backflip attempt #1 Too wobbly. :-( Too wobbly. :-( masterjames masterjames back backflip fail failed failing failure fence flip horrible life pitiful wobbly nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Backflip attempt #2 Tue, 03 Apr 2007 23:43:12 -0800

Author: masterjames
Added: Tue, 03 Apr 2007 23:43:12 -0800
Duration: 63

Nope... still too wobbly. :-(

]]> backbackflipfailfailedfailingfailurefencefliphorriblelifepitifulwobbly http://revver.com/video/224986/backflip-attempt-2/ http://revver.com/watch/224986 Backflip attempt #2 Nope... still too wobbly. :-( Nope... still too wobbly. :-( masterjames masterjames back backflip fail failed failing failure fence flip horrible life pitiful wobbly nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Almost there! Tue, 03 Apr 2007 23:43:12 -0800

Author: masterjames
Added: Tue, 03 Apr 2007 23:43:12 -0800
Duration: 7

The end of the journey is in sight!

]]> almostendingjourneyoversoontherewinter http://revver.com/video/224988/almost-there/ http://revver.com/watch/224988 Almost there! The end of the journey is in sight! The end of the journey is in sight! masterjames masterjames almost ending journey over soon there winter nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Crosswalk light changing Tue, 03 Apr 2007 23:43:12 -0800

Author: masterjames
Added: Tue, 03 Apr 2007 23:43:12 -0800
Duration: 8

ANTICIPATION! OHHHHH! CROSSING TIME!

]]> changingcrosswalklight http://revver.com/video/224993/crosswalk-light-changing/ http://revver.com/watch/224993 Crosswalk light changing ANTICIPATION! OHHHHH! CROSSING TIME! ANTICIPATION! OHHHHH! CROSSING TIME! masterjames masterjames changing crosswalk light nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Crossing last minute Tue, 03 Apr 2007 23:43:12 -0800

Author: masterjames
Added: Tue, 03 Apr 2007 23:43:12 -0800
Duration: 8

AH lights changing!

]]> changingcrosswalklight http://revver.com/video/224998/crossing-last-minute/ http://revver.com/watch/224998 Crossing last minute AH lights changing! AH lights changing! masterjames masterjames changing crosswalk light nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Run from road to sidewalk Tue, 03 Apr 2007 23:34:13 -0800

Author: masterjames
Added: Tue, 03 Apr 2007 23:34:13 -0800
Duration: 4

AH CAR! GET TO SIDEWALK!

]]> accidentdangerousdaredevilhappenj-walkingjwalkingmiddleroadrunningwaiting http://revver.com/video/224966/run-from-road-to-sidewalk/ http://revver.com/watch/224966 Run from road to sidewalk AH CAR! GET TO SIDEWALK! AH CAR! GET TO SIDEWALK! masterjames masterjames accident dangerous daredevil happen j-walking jwalking middle road running waiting nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Walking Tue, 03 Apr 2007 23:34:13 -0800

Author: masterjames
Added: Tue, 03 Apr 2007 23:34:13 -0800
Duration: 6

Walkin walkin

]]> aroundmumblingshitwalkin http://revver.com/video/224971/walking/ http://revver.com/watch/224971 Walking Walkin walkin Walkin walkin masterjames masterjames around mumbling shit walkin nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ JWALKING! Tue, 03 Apr 2007 23:34:13 -0800

Author: masterjames
Added: Tue, 03 Apr 2007 23:34:13 -0800
Duration: 8

PLEASE DON'T ARREST ME!

]]> dangerousdaredevildisobeyingj-walkingjwalkinglawrebelticketticketed http://revver.com/video/224974/jwalking/ http://revver.com/watch/224974 JWALKING! PLEASE DON'T ARREST ME! PLEASE DON'T ARREST ME! masterjames masterjames dangerous daredevil disobeying j-walking jwalking law rebel ticket ticketed nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Still haven't found what I'm looking for Tue, 03 Apr 2007 23:34:13 -0800

Author: masterjames
Added: Tue, 03 Apr 2007 23:34:13 -0800
Duration: 12

It needs to be perfect!

]]> foreverfoundhaventimjourneylookingstill http://revver.com/video/224977/still-havent-found-what-im-looking-for/ http://revver.com/watch/224977 Still haven't found what I'm looking for It needs to be perfect! It needs to be perfect! masterjames masterjames forever found havent im journey looking still nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Should of worn a hat Tue, 03 Apr 2007 23:34:13 -0800

Author: masterjames
Added: Tue, 03 Apr 2007 23:34:13 -0800
Duration: 5

Fudge its cold.

]]> breezebreezycoldfreezinghatsubzerowindywinter http://revver.com/video/224981/should-of-worn-a-hat/ http://revver.com/watch/224981 Should of worn a hat Fudge its cold. Fudge its cold. masterjames masterjames breeze breezy cold freezing hat subzero windy winter nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Smack that. Tue, 03 Apr 2007 23:34:13 -0800

Author: masterjames
Added: Tue, 03 Apr 2007 23:34:13 -0800
Duration: 11

Smack that. I'm retarded singing along.

]]> aloudassembarrassingpitifulretardedsadsingingsmack http://revver.com/video/224982/smack-that/ http://revver.com/watch/224982 Smack that. Smack that. I'm retarded singing along. Smack that. I'm retarded singing along. masterjames masterjames aloud ass embarrassing pitiful retarded sad singing smack nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Thinkin about a backflip Tue, 03 Apr 2007 23:25:12 -0800

Author: masterjames
Added: Tue, 03 Apr 2007 23:25:12 -0800
Duration: 6

hmm...

]]> backflipdoingflippingthinking http://revver.com/video/224969/thinkin-about-a-backflip/ http://revver.com/watch/224969 Thinkin about a backflip hmm... hmm... masterjames masterjames backflip doing flipping thinking nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Need a place for the camera first... Tue, 03 Apr 2007 23:25:12 -0800

Author: masterjames
Added: Tue, 03 Apr 2007 23:25:12 -0800
Duration: 6

Before i can backflip I need a place for my camera

]]> cameradigitalplacingrecordsomethingvideo http://revver.com/video/224970/need-a-place-for-the-camera-first/ http://revver.com/watch/224970 Need a place for the camera first... Before i can backflip I need a place for my camera Before i can backflip I need a place for my camera masterjames masterjames camera digital placing record something video nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ This is one long walk Tue, 03 Apr 2007 23:20:18 -0800

Author: masterjames
Added: Tue, 03 Apr 2007 23:20:18 -0800
Duration: 5

Barely 1/4 done. Watch the full video at http://one.revver.com/find/user/masterjames

]]> assboredlongtiredwalk http://revver.com/video/224964/this-is-one-long-walk/ http://revver.com/watch/224964 This is one long walk Barely 1/4 done. Watch the full video at http://one.revver.com/find/user/masterjames Barely 1/4 done. Watch the full video at http://one.revver.com/find/user/masterjames masterjames masterjames ass bored long tired walk nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Running in middle of road Tue, 03 Apr 2007 23:20:18 -0800

Author: masterjames
Added: Tue, 03 Apr 2007 23:20:18 -0800
Duration: 25

UH OHES!

]]> accidentdangerousdaredevilhappenj-walkingjwalkingmiddleroadrunningwaiting http://revver.com/video/224965/running-in-middle-of-road/ http://revver.com/watch/224965 Running in middle of road UH OHES! UH OHES! masterjames masterjames accident dangerous daredevil happen j-walking jwalking middle road running waiting nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Down the stairs Tue, 03 Apr 2007 23:04:14 -0800

Author: masterjames
Added: Tue, 03 Apr 2007 23:04:14 -0800
Duration: 23

Down the stairs I go.

]]> boycasualcoatgetpointlessstaircasestairssteppingteenwalkinwalkingweird http://revver.com/video/224949/down-the-stairs/ http://revver.com/watch/224949 Down the stairs Down the stairs I go. Down the stairs I go. Master James Master James boy casual coat get pointless staircase stairs stepping teen walkin walking weird nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Really sh*tty out Tue, 03 Apr 2007 23:04:14 -0800

Author: masterjames
Added: Tue, 03 Apr 2007 23:04:14 -0800
Duration: 4

Bad weather.

]]> coldconditionsdampdirtygrossicepoorpouringslushslushysnowwet http://revver.com/video/224952/really-shtty-out/ http://revver.com/watch/224952 Really sh*tty out Bad weather. Bad weather. masterjames masterjames cold conditions damp dirty gross ice poor pouring slush slushy snow wet nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Leather glove 2 + open door Tue, 03 Apr 2007 23:04:14 -0800

Author: masterjames
Added: Tue, 03 Apr 2007 23:04:14 -0800
Duration: 9

Putting it on and goin into the cold!

]]> colddoorfreezinggloveglovesleatherleatherglovesnowwarmwintercoat http://revver.com/video/224953/leather-glove-2-open-door/ http://revver.com/watch/224953 Leather glove 2 + open door Putting it on and goin into the cold! Putting it on and goin into the cold! masterjames masterjames cold door freezing glove gloves leather leatherglove snow warm wintercoat nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Putting leather glove on Tue, 03 Apr 2007 23:04:14 -0800

Author: masterjames
Added: Tue, 03 Apr 2007 23:04:14 -0800
Duration: 4

Yep, you guessed it. I put it on.

]]> gloveglovesleatherwearwearing http://revver.com/video/224956/putting-leather-glove-on/ http://revver.com/watch/224956 Putting leather glove on Yep, you guessed it. I put it on. Yep, you guessed it. I put it on. masterjames masterjames glove gloves leather wear wearing nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Walking in the snow Tue, 03 Apr 2007 23:04:14 -0800

Author: masterjames
Added: Tue, 03 Apr 2007 23:04:14 -0800
Duration: 11

Walking on the street.

]]> badconditionsgrossiceslushsnowweatherwet http://revver.com/video/224957/walking-in-the-snow/ http://revver.com/watch/224957 Walking in the snow Walking on the street. Walking on the street. masterjames masterjames bad conditions gross ice slush snow weather wet nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Jumping over snow bank Tue, 03 Apr 2007 23:04:14 -0800

Author: masterjames
Added: Tue, 03 Apr 2007 23:04:14 -0800
Duration: 6

didn't want to step in the puddle

]]> dampjumpjumpingoverpuddleslushsnowsnowywetwinter http://revver.com/video/224958/jumping-over-snow-bank/ http://revver.com/watch/224958 Jumping over snow bank didn't want to step in the puddle didn't want to step in the puddle masterjames masterjames damp jump jumping over puddle slush snow snowy wet winter nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Face shot in sky Tue, 03 Apr 2007 23:04:14 -0800

Author: masterjames
Added: Tue, 03 Apr 2007 23:04:14 -0800
Duration: 4

Yep... theres me walking.

]]> aviatorbackgroundcloudsglassesjamesmasterskysnowwalkingwinter http://revver.com/video/224959/face-shot-in-sky/ http://revver.com/watch/224959 Face shot in sky Yep... theres me walking. Yep... theres me walking. masterjames masterjames aviator background clouds glasses james master sky snow walking winter nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ More running Tue, 03 Apr 2007 23:04:14 -0800

Author: masterjames
Added: Tue, 03 Apr 2007 23:04:14 -0800
Duration: 6

More running in middle of the road

]]> daredevilj-walkingjwalkingmiddleroadrunning http://revver.com/video/224962/more-running/ http://revver.com/watch/224962 More running More running in middle of the road More running in middle of the road masterjames masterjames daredevil j-walking jwalking middle road running nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ ESH style workout Tue, 03 Apr 2007 22:55:15 -0800

Author: masterjames
Added: Tue, 03 Apr 2007 22:55:15 -0800
Duration: 163

Haha this is a great video I did. Yes the crash was faked... because my friend turned off the camera the first time when I actually did fall!!! so I tried to re-enact as best I could

]]> beastskillscardioconditioningcoolevolutionevolutionstopsherefunnyherehilariousinstructionalpainfulretardedstopsstrengthtrainingworkingoutworkout http://revver.com/video/224932/esh-style-workout/ http://revver.com/watch/224932 ESH style workout Haha this is a great video I did. Yes the crash was faked... because my friend turned off the camera the first time when I actually did fall!!! so I tried to re-enact as best I could Haha this is a great video I did. Yes the crash was faked... because my friend turned off the camera the first time when I actually did fall!!! so I tried to re-enact as best I could Master James & Joel Master James & Joel beastskills cardio conditioning cool evolution evolutionstopshere funny here hilarious instructional painful retarded stops strength training workingout workout nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Turning on my mp3 player Tue, 03 Apr 2007 22:55:15 -0800

Author: masterjames
Added: Tue, 03 Apr 2007 22:55:15 -0800
Duration: 19

Turning it on.. alllllllright

]]> brandingearbudsheadphonesipodknockoffmp3musicmuzakplayerplayingrcatunetunestuneskies http://revver.com/video/224943/turning-on-my-mp3-player/ http://revver.com/watch/224943 Turning on my mp3 player Turning it on.. alllllllright Turning it on.. alllllllright My mp3 player and my hand My mp3 player and my hand branding earbuds headphones ipod knockoff mp3 music muzak player playing rca tune tunes tuneskies nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ To the post office! Tue, 03 Apr 2007 22:34:11 -0800

Author: masterjames
Added: Tue, 03 Apr 2007 22:34:11 -0800
Duration: 289

My latest sponsor gear from evolutionstopshere.com arrived but no one was home so I had to trek it to the post office!!!

]]> bombcooldisgruntlededitingeffectsevolutionevolutionstopsherehellhellraiserheremailmailboxofficepackagepostpostalspecialspecialfxspookystopstesttimetripvideoworker http://revver.com/video/224933/to-the-post-office/ http://revver.com/watch/224933 To the post office! My latest sponsor gear from evolutionstopshere.com arrived but no one was home so I had to trek it to the post office!!! My latest sponsor gear from evolutionstopshere.com arrived but no one was home so I had to trek it to the post office!!! Master James Master James bomb cool disgruntled editing effects evolution evolutionstopshere hell hellraiser here mail mailbox office package post postal special specialfx spooky stops test time trip video worker nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Dentyne Ice Commercial ripoff Tue, 03 Apr 2007 22:20:24 -0800

Author: masterjames
Added: Tue, 03 Apr 2007 22:20:24 -0800
Duration: 17

Made this yeaaaaaars ago with my friend! Used some whacky video editing software that came with a tiny digicam

]]> adcommercialcrazydentynefunnyhilariousicelameoldschoolweird http://revver.com/video/224926/dentyne-ice-commercial-ripoff/ http://revver.com/watch/224926 Dentyne Ice Commercial ripoff Made this yeaaaaaars ago with my friend! Used some whacky video editing software that came with a tiny digicam Made this yeaaaaaars ago with my friend! Used some whacky video editing software that came with a tiny digicam Master James & Chris Master James & Chris ad commercial crazy dentyne funny hilarious ice lame old school weird nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Short design intro Tue, 03 Apr 2007 22:13:08 -0800

Author: masterjames
Added: Tue, 03 Apr 2007 22:13:08 -0800
Duration: 11

Short t-shirt design intro I did for www.evolutionstopshere.com Music by freeplay music

]]> devilevolutionstopsherehellhellraiserspecialfx http://revver.com/video/224925/short-design-intro/ http://revver.com/watch/224925 Short design intro Short t-shirt design intro I did for www.evolutionstopshere.com Music by freeplay music Short t-shirt design intro I did for www.evolutionstopshere.com Music by freeplay music Freeplay music Freeplay music devil evolutionstopshere hell hellraiser specialfx nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Richard's a bad friend. Mon, 02 Apr 2007 03:50:26 -0800

Author: masterjames
Added: Mon, 02 Apr 2007 03:50:26 -0800
Duration: 32

My thoughts about Richard after he fails to show up to hang out. It turned out he came like 15 min later. We showed him the video. Good times. He laughed

]]> badcoopsfriendfunnylamelonerrichardostrangestrangerstupidvideoweirdweirdowhack http://revver.com/video/221053/richards-a-bad-friend/ http://revver.com/watch/221053 Richard's a bad friend. My thoughts about Richard after he fails to show up to hang out. It turned out he came like 15 min later. We showed him the video. Good times. He laughed My thoughts about Richard after he fails to show up to hang out. It turned out he came like 15 min later. We showed him the video. Good times. He laughed Coops, and I filmed Coops, and I filmed bad coops friend funny lame loner richardo strange stranger stupid video weird weirdo whack nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ ESH Drink&Fight Bar Trick Tutorial #1 Sun, 01 Apr 2007 16:13:06 -0800

Author: masterjames
Added: Sun, 01 Apr 2007 16:13:06 -0800
Duration: 50

In this trick I will show you how to levitate a beer bottle on an inconspicuous corner of a wall. Enjoy. VISIT www.evolutionstopshere.com

]]> amazingbarbeerbottlecooldrinkdrinkfighteshevolutionfightfloatfloatingherelevitationmagicmagictrickpartystopstelekinesistrick http://revver.com/video/222105/esh-drinkfight-bar-trick-tutorial-1/ http://revver.com/watch/222105 ESH Drink&Fight Bar Trick Tutorial #1 In this trick I will show you how to levitate a beer bottle on an inconspicuous corner of a wall. Enjoy. VISIT www.evolutionstopshere.com In this trick I will show you how to levitate a beer bottle on an inconspicuous corner of a wall. Enjoy. VISIT www.evolutionstopshere.com Master James Master James amazing bar beer bottle cool drink drinkfight esh evolution fight float floating here levitation magic magictrick party stops telekinesis trick nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Amazing Zippo Trick #1! (MUST SEE) Sun, 01 Apr 2007 15:55:10 -0800

Author: masterjames
Added: Sun, 01 Apr 2007 15:55:10 -0800
Duration: 9

AMAZING! WHOAA WHOAA WHOAAAAAAAAa

]]> awesomecoolcrazydifficultincredibleinsaneinsanitylighterlightingtricktrickingzippo http://revver.com/video/222060/amazing-zippo-trick-1-must-see/ http://revver.com/watch/222060 Amazing Zippo Trick #1! (MUST SEE) AMAZING! WHOAA WHOAA WHOAAAAAAAAa AMAZING! WHOAA WHOAA WHOAAAAAAAAa masterjames masterjames awesome cool crazy difficult incredible insane insanity lighter lighting trick tricking zippo nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Amazing Zippo Trick #2! (MUST SEE) Sun, 01 Apr 2007 15:55:10 -0800

Author: masterjames
Added: Sun, 01 Apr 2007 15:55:10 -0800
Duration: 9

EVEN BETTER! WHOAAAAAA

]]> coolcrazyhahahalamelighterlosersmyspacerealstupidzippo http://revver.com/video/222061/amazing-zippo-trick-2-must-see/ http://revver.com/watch/222061 Amazing Zippo Trick #2! (MUST SEE) EVEN BETTER! WHOAAAAAA EVEN BETTER! WHOAAAAAA masterjames masterjames cool crazy hahaha lame lighter losers myspace real stupid zippo nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Youuuuuu are getting very sleepy (hyponotize) Sun, 01 Apr 2007 15:34:05 -0800

Author: masterjames
Added: Sun, 01 Apr 2007 15:34:05 -0800
Duration: 11

YOUUUUUU ARE GETTING VERY SLEEPY!

]]> hypotizeinsaneinsanitymentalmessedpyschoretardationretardedsleepsleepystupidupwhackwhacked http://revver.com/video/222027/youuuuuu-are-getting-very-sleepy-hyponotize/ http://revver.com/watch/222027 Youuuuuu are getting very sleepy (hyponotize) YOUUUUUU ARE GETTING VERY SLEEPY! YOUUUUUU ARE GETTING VERY SLEEPY! ME ME hypotize insane insanity mental messed pyscho retardation retarded sleep sleepy stupid up whack whacked nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ I bet Richard's wearing... Sun, 01 Apr 2007 12:22:12 -0800

Author: masterjames
Added: Sun, 01 Apr 2007 12:22:12 -0800
Duration: 27

We were so off when he finally showed up. This video is prior to the "Richard's a bad friend" video

]]> friendlamerichardo http://revver.com/video/221056/i-bet-richards-wearing/ http://revver.com/watch/221056 I bet Richard's wearing... We were so off when he finally showed up. This video is prior to the "Richard's a bad friend" video We were so off when he finally showed up. This video is prior to the "Richard's a bad friend" video masterjames masterjames friend lame richardo nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Spiting Richardo - Part 3 Sun, 01 Apr 2007 12:22:12 -0800

Author: masterjames
Added: Sun, 01 Apr 2007 12:22:12 -0800
Duration: 25

The final video of Coops' and my discussion.

]]> friendrichardostupid http://revver.com/video/221059/spiting-richardo-part-3/ http://revver.com/watch/221059 Spiting Richardo - Part 3 The final video of Coops' and my discussion. The final video of Coops' and my discussion. masterjames masterjames friend richardo stupid adult http://creativecommons.org/licenses/by-nc-nd/2.5/ RE: Bottle break attempts Fri, 30 Mar 2007 22:37:13 -0800

Author: masterjames
Added: Fri, 30 Mar 2007 22:37:13 -0800
Duration: 385

Haha my friends try! funny results! please watch through til the end!

]]> beerbottlebottombreakingexplodefuninterestingpartyshattersmashtrick http://revver.com/video/220272/re-bottle-break-attempts/ http://revver.com/watch/220272 RE: Bottle break attempts Haha my friends try! funny results! please watch through til the end! Haha my friends try! funny results! please watch through til the end! masterjames masterjames beer bottle bottom breaking explode fun interesting party shatter smash trick nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/