Videos by pregnancyshow Videos by pregnancyshow http://revver.com/u/pregnancyshow/ http://revver.com webmaster@revver.com Celebrity Baby Dish - Jan 28-Feb 1 2008 Thu, 31 Jan 2008 10:16:19 -0800

Author: pregnancyshow
Added: Thu, 31 Jan 2008 10:16:19 -0800
Duration: 68

Your ultimate source for all the celebrity baby news and gossip. We keep you up to date on the tots of tinsel town. For more information visit www.ThePregnancyShow.com

]]> babiesbabycaliforniacelebcelebritiescelebritycelebscinemaentertainmentfamousfilmhollywoodmovienewspregnancypregnantstarstarstelevisiontheatertv http://revver.com/video/648258/celebrity-baby-dish-jan-28-feb-1-2008/ http://revver.com/watch/648258 Celebrity Baby Dish - Jan 28-Feb 1 2008 Your ultimate source for all the celebrity baby news and gossip. We keep you up to date on the tots of tinsel town. For more information visit www.ThePregnancyShow.com Your ultimate source for all the celebrity baby news and gossip. We keep you up to date on the tots of tinsel town. For more information visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby california celeb celebrities celebrity celebs cinema entertainment famous film hollywood movie news pregnancy pregnant star stars television theater tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Infant CPR - Choking Part 2 Thu, 03 Jan 2008 13:56:17 -0800

Author: pregnancyshow
Added: Thu, 03 Jan 2008 13:56:17 -0800
Duration: 200

Learn what you can do in a life-threatening situation of a choking infant. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/597884/infant-cpr-choking-part-2/ http://revver.com/watch/597884 Infant CPR - Choking Part 2 Learn what you can do in a life-threatening situation of a choking infant. Visit www.ThePregnancyShow.com Learn what you can do in a life-threatening situation of a choking infant. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Infant CPR - Choking Part 3 Thu, 03 Jan 2008 13:56:17 -0800

Author: pregnancyshow
Added: Thu, 03 Jan 2008 13:56:17 -0800
Duration: 75

Learn what you can do in a life-threatening situation of a choking infant. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/597890/infant-cpr-choking-part-3/ http://revver.com/watch/597890 Infant CPR - Choking Part 3 Learn what you can do in a life-threatening situation of a choking infant. Visit www.ThePregnancyShow.com Learn what you can do in a life-threatening situation of a choking infant. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Infant CPR Wed, 02 Jan 2008 12:30:27 -0800

Author: pregnancyshow
Added: Wed, 02 Jan 2008 12:30:27 -0800
Duration: 246

Would you know what to do if your infant suddenly began to choke or stopped breathing? This informational video shows you step by step instructions on how to preform infant CPR. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/595866/infant-cpr/ http://revver.com/watch/595866 Infant CPR Would you know what to do if your infant suddenly began to choke or stopped breathing? This informational video shows you step by step instructions on how to preform infant CPR. Visit www.ThePregnancyShow.com Would you know what to do if your infant suddenly began to choke or stopped breathing? This informational video shows you step by step instructions on how to preform infant CPR. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Infant CPR Wed, 02 Jan 2008 11:36:24 -0800

Author: pregnancyshow
Added: Wed, 02 Jan 2008 11:36:24 -0800
Duration: 246

Would you know what to do if your infant suddenly began to choke or stopped breathing? This informational video shows you step by step instructions on how to preform infant CPR. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/595796/infant-cpr/ http://revver.com/watch/595796 Infant CPR Would you know what to do if your infant suddenly began to choke or stopped breathing? This informational video shows you step by step instructions on how to preform infant CPR. Visit www.ThePregnancyShow.com Would you know what to do if your infant suddenly began to choke or stopped breathing? This informational video shows you step by step instructions on how to preform infant CPR. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - The Contraceptive Ring Thu, 20 Dec 2007 09:40:12 -0800

Author: pregnancyshow
Added: Thu, 20 Dec 2007 09:40:12 -0800
Duration: 46

If your looking for information on methods of birth control learn all about the contraceptive ring. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/577959/mommys-minute-the-contraceptive-ring/ http://revver.com/watch/577959 Mommy's Minute - The Contraceptive Ring If your looking for information on methods of birth control learn all about the contraceptive ring. Visit www.ThePregnancyShow.com If your looking for information on methods of birth control learn all about the contraceptive ring. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Preventing Pregnancy and STDs: Condoms Thu, 20 Dec 2007 09:19:06 -0800

Author: pregnancyshow
Added: Thu, 20 Dec 2007 09:19:06 -0800
Duration: 57

If your looking for information on methods of birth control learn all about the condom. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/577873/mommys-minute-preventing-pregnancy-and-stds-condoms/ http://revver.com/watch/577873 Mommy's Minute - Preventing Pregnancy and STDs: Condoms If your looking for information on methods of birth control learn all about the condom. Visit www.ThePregnancyShow.com If your looking for information on methods of birth control learn all about the condom. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Preventing Pregnancy: Diaphragm Thu, 20 Dec 2007 09:19:06 -0800

Author: pregnancyshow
Added: Thu, 20 Dec 2007 09:19:06 -0800
Duration: 42

If your looking for information on methods of birth control learn all about the diaphragm. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/577885/mommys-minute-preventing-pregnancy-diaphragm/ http://revver.com/watch/577885 Mommy's Minute - Preventing Pregnancy: Diaphragm If your looking for information on methods of birth control learn all about the diaphragm. Visit www.ThePregnancyShow.com If your looking for information on methods of birth control learn all about the diaphragm. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Preventing Pregnancy: Spermicide Thu, 20 Dec 2007 09:19:06 -0800

Author: pregnancyshow
Added: Thu, 20 Dec 2007 09:19:06 -0800
Duration: 46

If your looking for information on methods of birth control learn all about spermicide. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/577905/mommys-minute-preventing-pregnancy-spermicide/ http://revver.com/watch/577905 Mommy's Minute - Preventing Pregnancy: Spermicide If your looking for information on methods of birth control learn all about spermicide. Visit www.ThePregnancyShow.com If your looking for information on methods of birth control learn all about spermicide. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Talking To Your Teens About Sex Thu, 20 Dec 2007 09:19:06 -0800

Author: pregnancyshow
Added: Thu, 20 Dec 2007 09:19:06 -0800
Duration: 64

Most parents of teenagers dread having the sex talk. But making sex an "off limits" topic may cause them to experiment without the proper knowledge about what they're getting themselves into. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/577914/mommys-minute-talking-to-your-teens-about-sex/ http://revver.com/watch/577914 Mommy's Minute - Talking To Your Teens About Sex Most parents of teenagers dread having the sex talk. But making sex an "off limits" topic may cause them to experiment without the proper knowledge about what they're getting themselves into. Visit www.ThePregnancyShow.com Most parents of teenagers dread having the sex talk. But making sex an "off limits" topic may cause them to experiment without the proper knowledge about what they're getting themselves into. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Intrauterine Device (IUD) Wed, 19 Dec 2007 14:58:06 -0800

Author: pregnancyshow
Added: Wed, 19 Dec 2007 14:58:06 -0800
Duration: 46

If your looking for information on methods of birth control learn all about the Intrauterine Device (IUD) that can provide protection for up to 12 years. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/576973/mommys-minute-intrauterine-device-iud/ http://revver.com/watch/576973 Mommy's Minute - Intrauterine Device (IUD) If your looking for information on methods of birth control learn all about the Intrauterine Device (IUD) that can provide protection for up to 12 years. Visit www.ThePregnancyShow.com If your looking for information on methods of birth control learn all about the Intrauterine Device (IUD) that can provide protection for up to 12 years. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Feng Shui: Repairs and Renovations Wed, 19 Dec 2007 10:55:29 -0800

Author: pregnancyshow
Added: Wed, 19 Dec 2007 10:55:29 -0800
Duration: 46

Feng Shui in your home can help promote healthy, positive energy for your baby. Get tips on how to create a good Feng Shui energy in your home. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/576451/mommys-minute-feng-shui-repairs-and-renovations/ http://revver.com/watch/576451 Mommy's Minute - Feng Shui: Repairs and Renovations Feng Shui in your home can help promote healthy, positive energy for your baby. Get tips on how to create a good Feng Shui energy in your home. Visit www.ThePregnancyShow.com Feng Shui in your home can help promote healthy, positive energy for your baby. Get tips on how to create a good Feng Shui energy in your home. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Feng Shui: Room Color Wed, 19 Dec 2007 10:55:29 -0800

Author: pregnancyshow
Added: Wed, 19 Dec 2007 10:55:29 -0800
Duration: 49

Feng Shui in your nursery can help promote healthy positive energy for your baby. Get tips on how to create a color scheme in order to surround your baby with good energy. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/576461/mommys-minute-feng-shui-room-color/ http://revver.com/watch/576461 Mommy's Minute - Feng Shui: Room Color Feng Shui in your nursery can help promote healthy positive energy for your baby. Get tips on how to create a color scheme in order to surround your baby with good energy. Visit www.ThePregnancyShow.com Feng Shui in your nursery can help promote healthy positive energy for your baby. Get tips on how to create a color scheme in order to surround your baby with good energy. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Feng Shui: Room Themes Wed, 19 Dec 2007 10:55:29 -0800

Author: pregnancyshow
Added: Wed, 19 Dec 2007 10:55:29 -0800
Duration: 47

When decorating your baby’s nursery it’s important to consider what types of designs or pictures will be hung on the wall as certain themes can cause good or bad energy. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/576492/mommys-minute-feng-shui-room-themes/ http://revver.com/watch/576492 Mommy's Minute - Feng Shui: Room Themes When decorating your baby’s nursery it’s important to consider what types of designs or pictures will be hung on the wall as certain themes can cause good or bad energy. Visit www.ThePregnancyShow.com When decorating your baby’s nursery it’s important to consider what types of designs or pictures will be hung on the wall as certain themes can cause good or bad energy. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Feng Shui: Movement and Lighting Tue, 18 Dec 2007 10:28:06 -0800

Author: pregnancyshow
Added: Tue, 18 Dec 2007 10:28:06 -0800
Duration: 47

Feng Shui in your nursery can help promote healthy positive energy for your baby. Learn the importance of movement and lighting to ensure good overall energy. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/560693/mommys-minute-feng-shui-movement-and-lighting/ http://revver.com/watch/560693 Mommy's Minute - Feng Shui: Movement and Lighting Feng Shui in your nursery can help promote healthy positive energy for your baby. Learn the importance of movement and lighting to ensure good overall energy. Visit www.ThePregnancyShow.com Feng Shui in your nursery can help promote healthy positive energy for your baby. Learn the importance of movement and lighting to ensure good overall energy. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Feng Shui: Location Of Bedroom Tue, 18 Dec 2007 09:55:09 -0800

Author: pregnancyshow
Added: Tue, 18 Dec 2007 09:55:09 -0800
Duration: 46

Feng Shui in your nursery can help promote healthy positive energy for your baby. Learn the importance of the location of your bedroom to ensure good overall energy. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/559831/mommys-minute-feng-shui-location-of-bedroom/ http://revver.com/watch/559831 Mommy's Minute - Feng Shui: Location Of Bedroom Feng Shui in your nursery can help promote healthy positive energy for your baby. Learn the importance of the location of your bedroom to ensure good overall energy. Visit www.ThePregnancyShow.com Feng Shui in your nursery can help promote healthy positive energy for your baby. Learn the importance of the location of your bedroom to ensure good overall energy. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Feng Shui: Furniture Arrangement Tue, 18 Dec 2007 09:55:09 -0800

Author: pregnancyshow
Added: Tue, 18 Dec 2007 09:55:09 -0800
Duration: 41

Feng Shui in your nursery can help promote healthy positive energy for your baby. Learn the importance of furniture placement to ensure good overall energy. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/557027/mommys-minute-feng-shui-furniture-arrangement/ http://revver.com/watch/557027 Mommy's Minute - Feng Shui: Furniture Arrangement Feng Shui in your nursery can help promote healthy positive energy for your baby. Learn the importance of furniture placement to ensure good overall energy. Visit www.ThePregnancyShow.com Feng Shui in your nursery can help promote healthy positive energy for your baby. Learn the importance of furniture placement to ensure good overall energy. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Emergency Contraceptives Tue, 18 Dec 2007 09:28:06 -0800

Author: pregnancyshow
Added: Tue, 18 Dec 2007 09:28:06 -0800
Duration: 50

If your contraception has failed, you may want to consider using emergency contraception. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/555329/mommys-minute-emergency-contraceptives/ http://revver.com/watch/555329 Mommy's Minute - Emergency Contraceptives If your contraception has failed, you may want to consider using emergency contraception. Visit www.ThePregnancyShow.com If your contraception has failed, you may want to consider using emergency contraception. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Contraceptive Sponges Tue, 18 Dec 2007 09:28:06 -0800

Author: pregnancyshow
Added: Tue, 18 Dec 2007 09:28:06 -0800
Duration: 50

If your looking for information on methods of birth control learn all about the contraceptive sponge. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/554923/mommys-minute-contraceptive-sponges/ http://revver.com/watch/554923 Mommy's Minute - Contraceptive Sponges If your looking for information on methods of birth control learn all about the contraceptive sponge. Visit www.ThePregnancyShow.com If your looking for information on methods of birth control learn all about the contraceptive sponge. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Feng Shui: Clutter Tue, 18 Dec 2007 09:28:06 -0800

Author: pregnancyshow
Added: Tue, 18 Dec 2007 09:28:06 -0800
Duration: 45

Feng Shui in your home can help promote healthy positive energy for your baby. One of the most important ways to obtain good energy for your child is to organize and clear away clutter in your house. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/556001/mommys-minute-feng-shui-clutter/ http://revver.com/watch/556001 Mommy's Minute - Feng Shui: Clutter Feng Shui in your home can help promote healthy positive energy for your baby. One of the most important ways to obtain good energy for your child is to organize and clear away clutter in your house. Visit www.ThePregnancyShow.com Feng Shui in your home can help promote healthy positive energy for your baby. One of the most important ways to obtain good energy for your child is to organize and clear away clutter in your house. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Feng Shui and Your Baby Tue, 18 Dec 2007 09:28:06 -0800

Author: pregnancyshow
Added: Tue, 18 Dec 2007 09:28:06 -0800
Duration: 43

Learn how Feng Shui can be an important tool to help ground your baby in a healthy and flourishing environment. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/555511/mommys-minute-feng-shui-and-your-baby/ http://revver.com/watch/555511 Mommy's Minute - Feng Shui and Your Baby Learn how Feng Shui can be an important tool to help ground your baby in a healthy and flourishing environment. Visit www.ThePregnancyShow.com Learn how Feng Shui can be an important tool to help ground your baby in a healthy and flourishing environment. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Birth Control: DMPA Shot Tue, 18 Dec 2007 09:10:09 -0800

Author: pregnancyshow
Added: Tue, 18 Dec 2007 09:10:09 -0800
Duration: 59

If you're looking for long lasting contraception, get information on the Depo-Provera birth control shot. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/553574/mommys-minute-birth-control-dmpa-shot/ http://revver.com/watch/553574 Mommy's Minute - Birth Control: DMPA Shot If you're looking for long lasting contraception, get information on the Depo-Provera birth control shot. Visit www.ThePregnancyShow.com If you're looking for long lasting contraception, get information on the Depo-Provera birth control shot. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Birth Control Patch Tue, 18 Dec 2007 09:10:09 -0800

Author: pregnancyshow
Added: Tue, 18 Dec 2007 09:10:09 -0800
Duration: 50

If your looking for information on methods of birth control learn all about the birth control patch. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/554176/mommys-minute-birth-control-patch/ http://revver.com/watch/554176 Mommy's Minute - Birth Control Patch If your looking for information on methods of birth control learn all about the birth control patch. Visit www.ThePregnancyShow.com If your looking for information on methods of birth control learn all about the birth control patch. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Pregnancy Constipation Thu, 13 Dec 2007 12:19:05 -0800

Author: pregnancyshow
Added: Thu, 13 Dec 2007 12:19:05 -0800
Duration: 42

Constipation during pregnancy affects approximately 50% of pregnant women which can lead to hemorrhoids. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/526642/mommys-minute-pregnancy-constipation/ http://revver.com/watch/526642 Mommy's Minute - Pregnancy Constipation Constipation during pregnancy affects approximately 50% of pregnant women which can lead to hemorrhoids. Visit www.ThePregnancyShow.com Constipation during pregnancy affects approximately 50% of pregnant women which can lead to hemorrhoids. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Pregnancy: Gum Disease Thu, 13 Dec 2007 12:19:05 -0800

Author: pregnancyshow
Added: Thu, 13 Dec 2007 12:19:05 -0800
Duration: 43

Learn the causes of gum disease during pregnancy and how you can prevent it. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/526644/mommys-minute-pregnancy-gum-disease/ http://revver.com/watch/526644 Mommy's Minute - Pregnancy: Gum Disease Learn the causes of gum disease during pregnancy and how you can prevent it. Visit www.ThePregnancyShow.com Learn the causes of gum disease during pregnancy and how you can prevent it. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Preventing Gum Disease Thu, 13 Dec 2007 12:19:05 -0800

Author: pregnancyshow
Added: Thu, 13 Dec 2007 12:19:05 -0800
Duration: 45

Get tips on how to prevent gum disease during pregnancy. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/526648/mommys-minute-preventing-gum-disease/ http://revver.com/watch/526648 Mommy's Minute - Preventing Gum Disease Get tips on how to prevent gum disease during pregnancy. Visit www.ThePregnancyShow.com Get tips on how to prevent gum disease during pregnancy. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Pregnancy Itching Thu, 13 Dec 2007 11:58:08 -0800

Author: pregnancyshow
Added: Thu, 13 Dec 2007 11:58:08 -0800
Duration: 44

Mild itching is common in pregnancy because of the increased blood supply to the skin. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/526625/mommys-minute-pregnancy-itching/ http://revver.com/watch/526625 Mommy's Minute - Pregnancy Itching Mild itching is common in pregnancy because of the increased blood supply to the skin. Visit www.ThePregnancyShow.com Mild itching is common in pregnancy because of the increased blood supply to the skin. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Pregnancy: Group B Strep Thu, 13 Dec 2007 11:40:13 -0800

Author: pregnancyshow
Added: Thu, 13 Dec 2007 11:40:13 -0800
Duration: 53

Group B Strep or (GBS) infection is an infection that 15-40% of healthy, adult women carry. Learn about the risks Group B strep poses to your baby. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/526605/mommys-minute-pregnancy-group-b-strep/ http://revver.com/watch/526605 Mommy's Minute - Pregnancy: Group B Strep Group B Strep or (GBS) infection is an infection that 15-40% of healthy, adult women carry. Learn about the risks Group B strep poses to your baby. Visit www.ThePregnancyShow.com Group B Strep or (GBS) infection is an infection that 15-40% of healthy, adult women carry. Learn about the risks Group B strep poses to your baby. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Vivid Pregnancy Dreams Thu, 13 Dec 2007 11:19:07 -0800

Author: pregnancyshow
Added: Thu, 13 Dec 2007 11:19:07 -0800
Duration: 49

Have you been experiencing a lot of strange, vivid dreams lately? Well rest assured these types of dreams are very common during pregnancy. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/526548/mommys-minute-vivid-pregnancy-dreams/ http://revver.com/watch/526548 Mommy's Minute - Vivid Pregnancy Dreams Have you been experiencing a lot of strange, vivid dreams lately? Well rest assured these types of dreams are very common during pregnancy. Visit www.ThePregnancyShow.com Have you been experiencing a lot of strange, vivid dreams lately? Well rest assured these types of dreams are very common during pregnancy. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Hair Growth in Pregnancy Thu, 13 Dec 2007 11:19:07 -0800

Author: pregnancyshow
Added: Thu, 13 Dec 2007 11:19:07 -0800
Duration: 52

Some pregnant women experience extra hair growth on their face and body during pregnancy. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/526556/mommys-minute-hair-growth-in-pregnancy/ http://revver.com/watch/526556 Mommy's Minute - Hair Growth in Pregnancy Some pregnant women experience extra hair growth on their face and body during pregnancy. Visit www.ThePregnancyShow.com Some pregnant women experience extra hair growth on their face and body during pregnancy. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Chicken Pox During Pregnancy Thu, 13 Dec 2007 11:19:07 -0800

Author: pregnancyshow
Added: Thu, 13 Dec 2007 11:19:07 -0800
Duration: 52

Find out how having the chicken pox during pregnancy can affect your baby and the serious dangers it can cause. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/526562/mommys-minute-chicken-pox-during-pregnancy/ http://revver.com/watch/526562 Mommy's Minute - Chicken Pox During Pregnancy Find out how having the chicken pox during pregnancy can affect your baby and the serious dangers it can cause. Visit www.ThePregnancyShow.com Find out how having the chicken pox during pregnancy can affect your baby and the serious dangers it can cause. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Pregnancy and Kegels Wed, 12 Dec 2007 12:58:06 -0800

Author: pregnancyshow
Added: Wed, 12 Dec 2007 12:58:06 -0800
Duration: 42

During pregnancy, the growing uterus places pressure on the bladder, making it easy to leak. To help prevent this, you’ll want to strengthen your pelvic muscles by practicing Kegels. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykegelkegelskidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/524983/mommys-minute-pregnancy-and-kegels/ http://revver.com/watch/524983 Mommy's Minute - Pregnancy and Kegels During pregnancy, the growing uterus places pressure on the bladder, making it easy to leak. To help prevent this, you’ll want to strengthen your pelvic muscles by practicing Kegels. Visit www.ThePregnancyShow.com During pregnancy, the growing uterus places pressure on the bladder, making it easy to leak. To help prevent this, you’ll want to strengthen your pelvic muscles by practicing Kegels. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kegel kegels kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Pregnancy Journals Wed, 12 Dec 2007 12:40:18 -0800

Author: pregnancyshow
Added: Wed, 12 Dec 2007 12:40:18 -0800
Duration: 43

Learn all about keeping a pregnancy journal to remember those special moments while you were pregnant. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/524929/mommys-minute-pregnancy-journals/ http://revver.com/watch/524929 Mommy's Minute - Pregnancy Journals Learn all about keeping a pregnancy journal to remember those special moments while you were pregnant. Visit www.ThePregnancyShow.com Learn all about keeping a pregnancy journal to remember those special moments while you were pregnant. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Getting A Good Night's Sleep Wed, 12 Dec 2007 12:40:18 -0800

Author: pregnancyshow
Added: Wed, 12 Dec 2007 12:40:18 -0800
Duration: 43

If you're pregnant and having trouble sleeping it's said that one hour of Yoga Nidra is equivalent to four hours of sleep. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermothersnidrapregnancypregnantsleeptelevisiontvyoga http://revver.com/video/524950/mommys-minute-getting-a-good-nights-sleep/ http://revver.com/watch/524950 Mommy's Minute - Getting A Good Night's Sleep If you're pregnant and having trouble sleeping it's said that one hour of Yoga Nidra is equivalent to four hours of sleep. Visit www.ThePregnancyShow.com If you're pregnant and having trouble sleeping it's said that one hour of Yoga Nidra is equivalent to four hours of sleep. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers nidra pregnancy pregnant sleep television tv yoga nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - How Pregnancy Makes You Smarter Wed, 12 Dec 2007 12:40:18 -0800

Author: pregnancyshow
Added: Wed, 12 Dec 2007 12:40:18 -0800
Duration: 52

While you may have experienced a few forgetful moments throughout your pregnancy, there is now evidence that shows that pregnancy can actually make you smarter. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/524959/mommys-minute-how-pregnancy-makes-you-smarter/ http://revver.com/watch/524959 Mommy's Minute - How Pregnancy Makes You Smarter While you may have experienced a few forgetful moments throughout your pregnancy, there is now evidence that shows that pregnancy can actually make you smarter. Visit www.ThePregnancyShow.com While you may have experienced a few forgetful moments throughout your pregnancy, there is now evidence that shows that pregnancy can actually make you smarter. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Pregnancy Indigestion Wed, 12 Dec 2007 12:40:18 -0800

Author: pregnancyshow
Added: Wed, 12 Dec 2007 12:40:18 -0800
Duration: 40

If you're pregnant and experiencing indigestion and heartburn get tips on how to prevent it. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityindigestioninfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/524971/mommys-minute-pregnancy-indigestion/ http://revver.com/watch/524971 Mommy's Minute - Pregnancy Indigestion If you're pregnant and experiencing indigestion and heartburn get tips on how to prevent it. Visit www.ThePregnancyShow.com If you're pregnant and experiencing indigestion and heartburn get tips on how to prevent it. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility indigestion infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Relieving Braxton Hicks Contractions Tue, 11 Dec 2007 13:58:06 -0800

Author: pregnancyshow
Added: Tue, 11 Dec 2007 13:58:06 -0800
Duration: 41

If you're pregnant get tips on how to relieve the discomfort of Braxton Hicks contractions. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/523299/mommys-minute-relieving-braxton-hicks-contractions/ http://revver.com/watch/523299 Mommy's Minute - Relieving Braxton Hicks Contractions If you're pregnant get tips on how to relieve the discomfort of Braxton Hicks contractions. Visit www.ThePregnancyShow.com If you're pregnant get tips on how to relieve the discomfort of Braxton Hicks contractions. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Pregnancy: Improving Your Memory Tue, 11 Dec 2007 13:10:15 -0800

Author: pregnancyshow
Added: Tue, 11 Dec 2007 13:10:15 -0800
Duration: 51

Get tips on how to improve your memory and keep your mind in tip top shape during pregnancy. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/523241/mommys-minute-pregnancy-improving-your-memory/ http://revver.com/watch/523241 Mommy's Minute - Pregnancy: Improving Your Memory Get tips on how to improve your memory and keep your mind in tip top shape during pregnancy. Visit www.ThePregnancyShow.com Get tips on how to improve your memory and keep your mind in tip top shape during pregnancy. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Pregnancy Mask Tue, 11 Dec 2007 12:49:07 -0800

Author: pregnancyshow
Added: Tue, 11 Dec 2007 12:49:07 -0800
Duration: 49

More than 70% of pregnant women will get chloasma (pregnancy mask) a skin discoloration where your skin may appear blotchy with brownish pigment. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/523185/mommys-minute-pregnancy-mask/ http://revver.com/watch/523185 Mommy's Minute - Pregnancy Mask More than 70% of pregnant women will get chloasma (pregnancy mask) a skin discoloration where your skin may appear blotchy with brownish pigment. Visit www.ThePregnancyShow.com More than 70% of pregnant women will get chloasma (pregnancy mask) a skin discoloration where your skin may appear blotchy with brownish pigment. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Braxton Hicks Contractions Tue, 11 Dec 2007 11:49:06 -0800

Author: pregnancyshow
Added: Tue, 11 Dec 2007 11:49:06 -0800
Duration: 53

As your pregnancy progresses, you may begin to notice a tightness in your uterus referred to as a Braxton Hicks contraction. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/523136/mommys-minute-braxton-hicks-contractions/ http://revver.com/watch/523136 Mommy's Minute - Braxton Hicks Contractions As your pregnancy progresses, you may begin to notice a tightness in your uterus referred to as a Braxton Hicks contraction. Visit www.ThePregnancyShow.com As your pregnancy progresses, you may begin to notice a tightness in your uterus referred to as a Braxton Hicks contraction. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Difference Between Braxton Hicks And Labor Contractions Tue, 11 Dec 2007 11:49:06 -0800

Author: pregnancyshow
Added: Tue, 11 Dec 2007 11:49:06 -0800
Duration: 49

Many women worry that they won’t be able to tell the difference between their Braxton Hicks contractions and the real signs of labor. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/523142/difference-between-braxton-hicks-and-labor-contractions/ http://revver.com/watch/523142 Difference Between Braxton Hicks And Labor Contractions Many women worry that they won’t be able to tell the difference between their Braxton Hicks contractions and the real signs of labor. Visit www.ThePregnancyShow.com Many women worry that they won’t be able to tell the difference between their Braxton Hicks contractions and the real signs of labor. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Prenatal Exercise: Choosing a Personal Trainer Tue, 11 Dec 2007 09:40:14 -0800

Author: pregnancyshow
Added: Tue, 11 Dec 2007 09:40:14 -0800
Duration: 70

If you are pregnant and want to start exercising it's important to seek out a personal trainer to help you get started on your prenatal routine. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/522863/prenatal-exercise-choosing-a-personal-trainer/ http://revver.com/watch/522863 Prenatal Exercise: Choosing a Personal Trainer If you are pregnant and want to start exercising it's important to seek out a personal trainer to help you get started on your prenatal routine. Visit www.ThePregnancyShow.com If you are pregnant and want to start exercising it's important to seek out a personal trainer to help you get started on your prenatal routine. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Benefits of Prenatal Exercise Tue, 11 Dec 2007 09:40:14 -0800

Author: pregnancyshow
Added: Tue, 11 Dec 2007 09:40:14 -0800
Duration: 87

Learn how exercising during pregnancy can help you maintain a healthy pregnancy weight. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/522869/benefits-of-prenatal-exercise/ http://revver.com/watch/522869 Benefits of Prenatal Exercise Learn how exercising during pregnancy can help you maintain a healthy pregnancy weight. Visit www.ThePregnancyShow.com Learn how exercising during pregnancy can help you maintain a healthy pregnancy weight. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Prenatal Exercise: Labor Benefits Tue, 11 Dec 2007 09:40:14 -0800

Author: pregnancyshow
Added: Tue, 11 Dec 2007 09:40:14 -0800
Duration: 95

Learn how prenatal exercise can help ease the pain of labor and make labor shorter. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/522877/prenatal-exercise-labor-benefits/ http://revver.com/watch/522877 Prenatal Exercise: Labor Benefits Learn how prenatal exercise can help ease the pain of labor and make labor shorter. Visit www.ThePregnancyShow.com Learn how prenatal exercise can help ease the pain of labor and make labor shorter. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Not Exercising During Pregnancy: Risks Tue, 11 Dec 2007 09:40:14 -0800

Author: pregnancyshow
Added: Tue, 11 Dec 2007 09:40:14 -0800
Duration: 95

Learn about the negative affects pregnancy can have on a women who isn't physically active. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/522889/not-exercising-during-pregnancy-risks/ http://revver.com/watch/522889 Not Exercising During Pregnancy: Risks Learn about the negative affects pregnancy can have on a women who isn't physically active. Visit www.ThePregnancyShow.com Learn about the negative affects pregnancy can have on a women who isn't physically active. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Prenatal Exercise: Preventing Varicose Veins Tue, 11 Dec 2007 09:40:14 -0800

Author: pregnancyshow
Added: Tue, 11 Dec 2007 09:40:14 -0800
Duration: 68

Learn how prenatal exercise can promote circulation and help prevent varicose veins. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/522897/prenatal-exercise-preventing-varicose-veins/ http://revver.com/watch/522897 Prenatal Exercise: Preventing Varicose Veins Learn how prenatal exercise can promote circulation and help prevent varicose veins. Visit www.ThePregnancyShow.com Learn how prenatal exercise can promote circulation and help prevent varicose veins. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Prenatal Exercise With Fit Mom Tue, 11 Dec 2007 09:19:07 -0800

Author: pregnancyshow
Added: Tue, 11 Dec 2007 09:19:07 -0800
Duration: 181

Andrea Page, founder of Fit Mom Canada, offers prenatal classes such as this Fit Mom 2 Be class that helps pregnant women maintain strong muscular balance for pregnancy. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexerciseexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/522852/prenatal-exercise-with-fit-mom/ http://revver.com/watch/522852 Prenatal Exercise With Fit Mom Andrea Page, founder of Fit Mom Canada, offers prenatal classes such as this Fit Mom 2 Be class that helps pregnant women maintain strong muscular balance for pregnancy. Visit www.ThePregnancyShow.com Andrea Page, founder of Fit Mom Canada, offers prenatal classes such as this Fit Mom 2 Be class that helps pregnant women maintain strong muscular balance for pregnancy. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment exercise expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Prenatal Exercise: Abdominals Tue, 11 Dec 2007 09:19:07 -0800

Author: pregnancyshow
Added: Tue, 11 Dec 2007 09:19:07 -0800
Duration: 91

Prenatal exercise offers many benefits to a pregnant women. Andrea Page, personal trainer and founder of Fit Mom Canada talks about the importance of exercising your abdominal muscles during pregnancy. Visit www.ThePregnancyShow.com

]]> abdominalsbabiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexerciseexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/522855/prenatal-exercise-abdominals/ http://revver.com/watch/522855 Prenatal Exercise: Abdominals Prenatal exercise offers many benefits to a pregnant women. Andrea Page, personal trainer and founder of Fit Mom Canada talks about the importance of exercising your abdominal muscles during pregnancy. Visit www.ThePregnancyShow.com Prenatal exercise offers many benefits to a pregnant women. Andrea Page, personal trainer and founder of Fit Mom Canada talks about the importance of exercising your abdominal muscles during pregnancy. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow abdominals babies baby breastfed breastfeed breastfeeding child children entertainment exercise expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Triple Screening Test Fri, 07 Dec 2007 12:49:06 -0800

Author: pregnancyshow
Added: Fri, 07 Dec 2007 12:49:06 -0800
Duration: 49

A Triple screen test can indicate whether your baby will have genetic problems. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/516580/mommys-minute-triple-screening-test/ http://revver.com/watch/516580 Mommy's Minute - Triple Screening Test A Triple screen test can indicate whether your baby will have genetic problems. Visit www.ThePregnancyShow.com A Triple screen test can indicate whether your baby will have genetic problems. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Varicose Veins Fri, 07 Dec 2007 12:49:06 -0800

Author: pregnancyshow
Added: Fri, 07 Dec 2007 12:49:06 -0800
Duration: 52

During pregnancy, hormonal changes, and increased pressure in your abdomen can cause varicose veins to appear. Get tips on how to get rid of varicose veins. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/516584/mommys-minute-varicose-veins/ http://revver.com/watch/516584 Mommy's Minute - Varicose Veins During pregnancy, hormonal changes, and increased pressure in your abdomen can cause varicose veins to appear. Get tips on how to get rid of varicose veins. Visit www.ThePregnancyShow.com During pregnancy, hormonal changes, and increased pressure in your abdomen can cause varicose veins to appear. Get tips on how to get rid of varicose veins. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Maternal Screening Tests Fri, 07 Dec 2007 12:28:07 -0800

Author: pregnancyshow
Added: Fri, 07 Dec 2007 12:28:07 -0800
Duration: 45

A maternal screening test can indicate whether your baby will have Downs Syndrome or neural tube defects. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/516561/mommys-minute-maternal-screening-tests/ http://revver.com/watch/516561 Mommy's Minute - Maternal Screening Tests A maternal screening test can indicate whether your baby will have Downs Syndrome or neural tube defects. Visit www.ThePregnancyShow.com A maternal screening test can indicate whether your baby will have Downs Syndrome or neural tube defects. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Pregnancy and Your Pet Fri, 07 Dec 2007 12:28:07 -0800

Author: pregnancyshow
Added: Fri, 07 Dec 2007 12:28:07 -0800
Duration: 54

Join The Pregnancy Show this week for our Mom Panel Discussion about the benefits to breastfeeding, with helpful tips, and some interesting breastfeeding stories. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/516569/mommys-minute-pregnancy-and-your-pet/ http://revver.com/watch/516569 Mommy's Minute - Pregnancy and Your Pet Join The Pregnancy Show this week for our Mom Panel Discussion about the benefits to breastfeeding, with helpful tips, and some interesting breastfeeding stories. Visit www.ThePregnancyShow.com Join The Pregnancy Show this week for our Mom Panel Discussion about the benefits to breastfeeding, with helpful tips, and some interesting breastfeeding stories. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Quadruple Screening Test Fri, 07 Dec 2007 12:28:07 -0800

Author: pregnancyshow
Added: Fri, 07 Dec 2007 12:28:07 -0800
Duration: 46

One of the newest maternal screening tests is called the quadruple test and can indicate your baby's risk of Downs Syndrome. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/516573/mommys-minute-quadruple-screening-test/ http://revver.com/watch/516573 Mommy's Minute - Quadruple Screening Test One of the newest maternal screening tests is called the quadruple test and can indicate your baby's risk of Downs Syndrome. Visit www.ThePregnancyShow.com One of the newest maternal screening tests is called the quadruple test and can indicate your baby's risk of Downs Syndrome. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Gender Disappointment Fri, 07 Dec 2007 12:10:11 -0800

Author: pregnancyshow
Added: Fri, 07 Dec 2007 12:10:11 -0800
Duration: 57

While most pregnant women may not admit it, it’s quite normal to have a gender preference. But what happens if you find out it’s a boy and you were hoping for a girl or vise versa. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/516540/mommys-minute-gender-disappointment/ http://revver.com/watch/516540 Mommy's Minute - Gender Disappointment While most pregnant women may not admit it, it’s quite normal to have a gender preference. But what happens if you find out it’s a boy and you were hoping for a girl or vise versa. Visit www.ThePregnancyShow.com While most pregnant women may not admit it, it’s quite normal to have a gender preference. But what happens if you find out it’s a boy and you were hoping for a girl or vise versa. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Safe Medications While Breastfeeding Fri, 07 Dec 2007 10:25:09 -0800

Author: pregnancyshow
Added: Fri, 07 Dec 2007 10:25:09 -0800
Duration: 45

If you’re taking medications while breastfeeding learn how to check if a drug is safe to take. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/516395/mommys-minute-safe-medications-while-breastfeeding/ http://revver.com/watch/516395 Mommy's Minute - Safe Medications While Breastfeeding If you’re taking medications while breastfeeding learn how to check if a drug is safe to take. Visit www.ThePregnancyShow.com If you’re taking medications while breastfeeding learn how to check if a drug is safe to take. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Alpha-Feto Protein Test Fri, 07 Dec 2007 10:25:09 -0800

Author: pregnancyshow
Added: Fri, 07 Dec 2007 10:25:09 -0800
Duration: 40

A alpha-feto protein test can indicate whether your baby will have Downs Syndrome or neural tube defects. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/516398/mommys-minute-alpha-feto-protein-test/ http://revver.com/watch/516398 Mommy's Minute - Alpha-Feto Protein Test A alpha-feto protein test can indicate whether your baby will have Downs Syndrome or neural tube defects. Visit www.ThePregnancyShow.com A alpha-feto protein test can indicate whether your baby will have Downs Syndrome or neural tube defects. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Cystic Fibrosis Screen Test Fri, 07 Dec 2007 10:25:09 -0800

Author: pregnancyshow
Added: Fri, 07 Dec 2007 10:25:09 -0800
Duration: 52

The CF carrier screen is a blood test taken by parents to determine the risk of having a child with Cystic Fibrosis. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/516405/mommys-minute-cystic-fibrosis-screen-test/ http://revver.com/watch/516405 Mommy's Minute - Cystic Fibrosis Screen Test The CF carrier screen is a blood test taken by parents to determine the risk of having a child with Cystic Fibrosis. Visit www.ThePregnancyShow.com The CF carrier screen is a blood test taken by parents to determine the risk of having a child with Cystic Fibrosis. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Breastfeeding and Taking Medicine Fri, 07 Dec 2007 10:13:07 -0800

Author: pregnancyshow
Added: Fri, 07 Dec 2007 10:13:07 -0800
Duration: 53

If you’re breastfeeding and taking medications be very cautious as those medications can be passed to your child. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/516369/mommys-minute-breastfeeding-and-taking-medicine/ http://revver.com/watch/516369 Mommy's Minute - Breastfeeding and Taking Medicine If you’re breastfeeding and taking medications be very cautious as those medications can be passed to your child. Visit www.ThePregnancyShow.com If you’re breastfeeding and taking medications be very cautious as those medications can be passed to your child. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Breastfeeding and Your Diet Fri, 07 Dec 2007 10:13:07 -0800

Author: pregnancyshow
Added: Fri, 07 Dec 2007 10:13:07 -0800
Duration: 47

If you're breastfeeding learn all about the importance of maintaining a healthy diet and how your diet can affect your breast milk. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/516371/mommys-minute-breastfeeding-and-your-diet/ http://revver.com/watch/516371 Mommy's Minute - Breastfeeding and Your Diet If you're breastfeeding learn all about the importance of maintaining a healthy diet and how your diet can affect your breast milk. Visit www.ThePregnancyShow.com If you're breastfeeding learn all about the importance of maintaining a healthy diet and how your diet can affect your breast milk. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Clogged Milk Ducts Fri, 07 Dec 2007 10:13:07 -0800

Author: pregnancyshow
Added: Fri, 07 Dec 2007 10:13:07 -0800
Duration: 46

Sometimes while you breastfeed your milk ducts can get plugged causing small, red and tender lumps to form on your breast. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/516384/mommys-minute-clogged-milk-ducts/ http://revver.com/watch/516384 Mommy's Minute - Clogged Milk Ducts Sometimes while you breastfeed your milk ducts can get plugged causing small, red and tender lumps to form on your breast. Visit www.ThePregnancyShow.com Sometimes while you breastfeed your milk ducts can get plugged causing small, red and tender lumps to form on your breast. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Flat or Inverted Nipples Fri, 07 Dec 2007 10:13:07 -0800

Author: pregnancyshow
Added: Fri, 07 Dec 2007 10:13:07 -0800
Duration: 55

If you're breastfeeding and have flat or inverted nipples it can be difficult for your baby to get a proper latch on. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/516389/mommys-minute-flat-or-inverted-nipples/ http://revver.com/watch/516389 Mommy's Minute - Flat or Inverted Nipples If you're breastfeeding and have flat or inverted nipples it can be difficult for your baby to get a proper latch on. Visit www.ThePregnancyShow.com If you're breastfeeding and have flat or inverted nipples it can be difficult for your baby to get a proper latch on. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Getting Pregnant While Breastfeeding Fri, 07 Dec 2007 10:13:07 -0800

Author: pregnancyshow
Added: Fri, 07 Dec 2007 10:13:07 -0800
Duration: 49

Some new mothers wonder if they can get pregnant while breastfeeding. Most women who breastfeed full time don't get their periods. Under LAM guidelines, you are less than 2% likely to get pregnant. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/516390/mommys-minute-getting-pregnant-while-breastfeeding/ http://revver.com/watch/516390 Mommy's Minute - Getting Pregnant While Breastfeeding Some new mothers wonder if they can get pregnant while breastfeeding. Most women who breastfeed full time don't get their periods. Under LAM guidelines, you are less than 2% likely to get pregnant. Visit www.ThePregnancyShow.com Some new mothers wonder if they can get pregnant while breastfeeding. Most women who breastfeed full time don't get their periods. Under LAM guidelines, you are less than 2% likely to get pregnant. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Nipple Vasospasms Fri, 07 Dec 2007 10:13:07 -0800

Author: pregnancyshow
Added: Fri, 07 Dec 2007 10:13:07 -0800
Duration: 52

If you’re breastfeeding and suffer from painful stabbing sensations in your chest area and back you could have nipple vasospasms. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/516391/mommys-minute-nipple-vasospasms/ http://revver.com/watch/516391 Mommy's Minute - Nipple Vasospasms If you’re breastfeeding and suffer from painful stabbing sensations in your chest area and back you could have nipple vasospasms. Visit www.ThePregnancyShow.com If you’re breastfeeding and suffer from painful stabbing sensations in your chest area and back you could have nipple vasospasms. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Benefits Of Pregnancy Fri, 07 Dec 2007 09:58:06 -0800

Author: pregnancyshow
Added: Fri, 07 Dec 2007 09:58:06 -0800
Duration: 63

We're all familiar with the negative aspects of pregnancy like stretch marks and morning sickness but learn all about the benefits of being pregnant and all the good things to look forward to. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/516358/mommys-minute-benefits-of-pregnancy/ http://revver.com/watch/516358 Mommy's Minute - Benefits Of Pregnancy We're all familiar with the negative aspects of pregnancy like stretch marks and morning sickness but learn all about the benefits of being pregnant and all the good things to look forward to. Visit www.ThePregnancyShow.com We're all familiar with the negative aspects of pregnancy like stretch marks and morning sickness but learn all about the benefits of being pregnant and all the good things to look forward to. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Controlling Maternal Asthma Tue, 04 Dec 2007 09:55:15 -0800

Author: pregnancyshow
Added: Tue, 04 Dec 2007 09:55:15 -0800
Duration: 55

If you suffer from Maternal Asthma the most important thing is keeping it under control throughout your pregnancy or you could be putting your baby's life in danger. Visit www.ThePregnancyShow.com

]]> asthmababiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmaternalmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/510690/mommys-minute-controlling-maternal-asthma/ http://revver.com/watch/510690 Mommy's Minute - Controlling Maternal Asthma If you suffer from Maternal Asthma the most important thing is keeping it under control throughout your pregnancy or you could be putting your baby's life in danger. Visit www.ThePregnancyShow.com If you suffer from Maternal Asthma the most important thing is keeping it under control throughout your pregnancy or you could be putting your baby's life in danger. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow asthma babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids maternal mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Genetic Counselor and Family Medical History Tue, 04 Dec 2007 09:55:15 -0800

Author: pregnancyshow
Added: Tue, 04 Dec 2007 09:55:15 -0800
Duration: 57

If you are going to see a genetic counselor it’s important to gather as much information on yours and your partner’s family medical history as you can. Find out what important information too look for. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrencounselorentertainmentexpectingfertilitygenetichistoryinfertilitykidkidsmedicalmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/510701/mommys-minute-genetic-counselor-and-family-medical-history/ http://revver.com/watch/510701 Mommy's Minute - Genetic Counselor and Family Medical History If you are going to see a genetic counselor it’s important to gather as much information on yours and your partner’s family medical history as you can. Find out what important information too look for. Visit www.ThePregnancyShow.com If you are going to see a genetic counselor it’s important to gather as much information on yours and your partner’s family medical history as you can. Find out what important information too look for. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children counselor entertainment expecting fertility genetic history infertility kid kids medical mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Is Your Baby Getting Enough Breast Milk? Tue, 04 Dec 2007 09:55:15 -0800

Author: pregnancyshow
Added: Tue, 04 Dec 2007 09:55:15 -0800
Duration: 55

Learn how to determine if your baby is getting enough breast milk and how to increase your milk supply. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/510708/mommys-minute-is-your-baby-getting-enough-breast-milk/ http://revver.com/watch/510708 Mommy's Minute - Is Your Baby Getting Enough Breast Milk? Learn how to determine if your baby is getting enough breast milk and how to increase your milk supply. Visit www.ThePregnancyShow.com Learn how to determine if your baby is getting enough breast milk and how to increase your milk supply. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Hyperlactation Tue, 04 Dec 2007 09:55:15 -0800

Author: pregnancyshow
Added: Tue, 04 Dec 2007 09:55:15 -0800
Duration: 63

Some mothers have hyperlactation meaning an overabundance of breast milk. This causes milk to spray or leak out of the breast during breastfeeding which causes some babies to choke or gag on the first spray of milk. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityhyperlactationinfertilitykidkidslactationmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/510713/mommys-minute-hyperlactation/ http://revver.com/watch/510713 Mommy's Minute - Hyperlactation Some mothers have hyperlactation meaning an overabundance of breast milk. This causes milk to spray or leak out of the breast during breastfeeding which causes some babies to choke or gag on the first spray of milk. Visit www.ThePregnancyShow.com Some mothers have hyperlactation meaning an overabundance of breast milk. This causes milk to spray or leak out of the breast during breastfeeding which causes some babies to choke or gag on the first spray of milk. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility hyperlactation infertility kid kids lactation mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Risks Of Maternal Asthma Fri, 30 Nov 2007 14:43:05 -0800

Author: pregnancyshow
Added: Fri, 30 Nov 2007 14:43:05 -0800
Duration: 60

If you are pregnant and are an asthma sufferer learn all about the risks uncontrolled asthma can have on your baby. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/505624/mommys-minute-risks-of-maternal-asthma/ http://revver.com/watch/505624 Mommy's Minute - Risks Of Maternal Asthma If you are pregnant and are an asthma sufferer learn all about the risks uncontrolled asthma can have on your baby. Visit www.ThePregnancyShow.com If you are pregnant and are an asthma sufferer learn all about the risks uncontrolled asthma can have on your baby. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Premature Babies: The Risks Fri, 30 Nov 2007 14:43:05 -0800

Author: pregnancyshow
Added: Fri, 30 Nov 2007 14:43:05 -0800
Duration: 50

Premature babies are at the greatest risk of developing serious medical conditions. Learn about some of the problems your premature baby could be faced with. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/505629/mommys-minute-premature-babies-the-risks/ http://revver.com/watch/505629 Mommy's Minute - Premature Babies: The Risks Premature babies are at the greatest risk of developing serious medical conditions. Learn about some of the problems your premature baby could be faced with. Visit www.ThePregnancyShow.com Premature babies are at the greatest risk of developing serious medical conditions. Learn about some of the problems your premature baby could be faced with. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Hereditary Birth Defects Fri, 30 Nov 2007 14:43:05 -0800

Author: pregnancyshow
Added: Fri, 30 Nov 2007 14:43:05 -0800
Duration: 53

It’s important to be aware of the possibilities of having a child with a birth defect. Learn all about hereditary birth defects and how they're passed along to your child. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/505632/mommys-minute-hereditary-birth-defects/ http://revver.com/watch/505632 Mommy's Minute - Hereditary Birth Defects It’s important to be aware of the possibilities of having a child with a birth defect. Learn all about hereditary birth defects and how they're passed along to your child. Visit www.ThePregnancyShow.com It’s important to be aware of the possibilities of having a child with a birth defect. Learn all about hereditary birth defects and how they're passed along to your child. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - What Is Colostrum? Fri, 30 Nov 2007 14:43:05 -0800

Author: pregnancyshow
Added: Fri, 30 Nov 2007 14:43:05 -0800
Duration: 53

During the first couple of days after birth, you will produce breast milk known as colostrum. Learn all about the benefits to this rich nutrient filled breast milk that's only available a couple days after delivery. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/505634/mommys-minute-what-is-colostrum/ http://revver.com/watch/505634 Mommy's Minute - What Is Colostrum? During the first couple of days after birth, you will produce breast milk known as colostrum. Learn all about the benefits to this rich nutrient filled breast milk that's only available a couple days after delivery. Visit www.ThePregnancyShow.com During the first couple of days after birth, you will produce breast milk known as colostrum. Learn all about the benefits to this rich nutrient filled breast milk that's only available a couple days after delivery. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - What Is A Genetic Counselor? Fri, 30 Nov 2007 14:43:05 -0800

Author: pregnancyshow
Added: Fri, 30 Nov 2007 14:43:05 -0800
Duration: 61

If you have a known or suspected family history of birth defects or are over the age of 35 and are thinking about getting pregnant, it’s time to see a genetic counselor. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/505637/mommys-minute-what-is-a-genetic-counselor/ http://revver.com/watch/505637 Mommy's Minute - What Is A Genetic Counselor? If you have a known or suspected family history of birth defects or are over the age of 35 and are thinking about getting pregnant, it’s time to see a genetic counselor. Visit www.ThePregnancyShow.com If you have a known or suspected family history of birth defects or are over the age of 35 and are thinking about getting pregnant, it’s time to see a genetic counselor. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Soothing Sore Nipples Fri, 30 Nov 2007 14:34:06 -0800

Author: pregnancyshow
Added: Fri, 30 Nov 2007 14:34:06 -0800
Duration: 50

If you are breastfeeding, get great tips on how to soothe those sore nipples. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/505579/mommys-minute-soothing-sore-nipples/ http://revver.com/watch/505579 Mommy's Minute - Soothing Sore Nipples If you are breastfeeding, get great tips on how to soothe those sore nipples. Visit www.ThePregnancyShow.com If you are breastfeeding, get great tips on how to soothe those sore nipples. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Preparing Breast Milk Fri, 30 Nov 2007 14:34:06 -0800

Author: pregnancyshow
Added: Fri, 30 Nov 2007 14:34:06 -0800
Duration: 42

If you're pumping your breast milk learn how to prepare the milk properly for baby's feeding time. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/505584/mommys-minute-preparing-breast-milk/ http://revver.com/watch/505584 Mommy's Minute - Preparing Breast Milk If you're pumping your breast milk learn how to prepare the milk properly for baby's feeding time. Visit www.ThePregnancyShow.com If you're pumping your breast milk learn how to prepare the milk properly for baby's feeding time. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - What Is Pregnancy Bed Rest? Fri, 30 Nov 2007 13:55:10 -0800

Author: pregnancyshow
Added: Fri, 30 Nov 2007 13:55:10 -0800
Duration: 52

Learn about the two types of pregnancy bed rest and what they involve. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/505552/mommys-minute-what-is-pregnancy-bed-rest/ http://revver.com/watch/505552 Mommy's Minute - What Is Pregnancy Bed Rest? Learn about the two types of pregnancy bed rest and what they involve. Visit www.ThePregnancyShow.com Learn about the two types of pregnancy bed rest and what they involve. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - What Is Pregnancy Bed Rest? Fri, 30 Nov 2007 13:55:10 -0800

Author: pregnancyshow
Added: Fri, 30 Nov 2007 13:55:10 -0800
Duration: 52

Learn about the two types of pregnancy bed rest and what they involve. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/505553/mommys-minute-what-is-pregnancy-bed-rest/ http://revver.com/watch/505553 Mommy's Minute - What Is Pregnancy Bed Rest? Learn about the two types of pregnancy bed rest and what they involve. Visit www.ThePregnancyShow.com Learn about the two types of pregnancy bed rest and what they involve. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Tips On Buying A Breast Pump Fri, 30 Nov 2007 13:55:10 -0800

Author: pregnancyshow
Added: Fri, 30 Nov 2007 13:55:10 -0800
Duration: 50

If you're thinking about pumping your breast milk get tips on how to choose the right breast pump. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/505557/mommys-minute-tips-on-buying-a-breast-pump/ http://revver.com/watch/505557 Mommy's Minute - Tips On Buying A Breast Pump If you're thinking about pumping your breast milk get tips on how to choose the right breast pump. Visit www.ThePregnancyShow.com If you're thinking about pumping your breast milk get tips on how to choose the right breast pump. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - What Is Pregnancy Bed Rest? Fri, 30 Nov 2007 13:49:05 -0800

Author: pregnancyshow
Added: Fri, 30 Nov 2007 13:49:05 -0800
Duration: 52

Learn about the two types of pregnancy bed rest and what they involve. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/505549/mommys-minute-what-is-pregnancy-bed-rest/ http://revver.com/watch/505549 Mommy's Minute - What Is Pregnancy Bed Rest? Learn about the two types of pregnancy bed rest and what they involve. Visit www.ThePregnancyShow.com Learn about the two types of pregnancy bed rest and what they involve. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - What Is Pregnancy Bed Rest? Fri, 30 Nov 2007 13:49:05 -0800

Author: pregnancyshow
Added: Fri, 30 Nov 2007 13:49:05 -0800
Duration: 52

Learn about the two types of pregnancy bed rest and what they involve. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/505550/mommys-minute-what-is-pregnancy-bed-rest/ http://revver.com/watch/505550 Mommy's Minute - What Is Pregnancy Bed Rest? Learn about the two types of pregnancy bed rest and what they involve. Visit www.ThePregnancyShow.com Learn about the two types of pregnancy bed rest and what they involve. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - What Is Pregnancy Bed Rest? Fri, 30 Nov 2007 13:49:05 -0800

Author: pregnancyshow
Added: Fri, 30 Nov 2007 13:49:05 -0800
Duration: 52

Learn about the two types of pregnancy bed rest and what they involve. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/505551/mommys-minute-what-is-pregnancy-bed-rest/ http://revver.com/watch/505551 Mommy's Minute - What Is Pregnancy Bed Rest? Learn about the two types of pregnancy bed rest and what they involve. Visit www.ThePregnancyShow.com Learn about the two types of pregnancy bed rest and what they involve. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Weaning Your Baby Fri, 30 Nov 2007 13:25:12 -0800

Author: pregnancyshow
Added: Fri, 30 Nov 2007 13:25:12 -0800
Duration: 46

If it’s that time to start weaning your child off of breast milk get tips on how to make the transition easier. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontvweaning http://revver.com/video/505516/mommys-minute-weaning-your-baby/ http://revver.com/watch/505516 Mommy's Minute - Weaning Your Baby If it’s that time to start weaning your child off of breast milk get tips on how to make the transition easier. Visit www.ThePregnancyShow.com If it’s that time to start weaning your child off of breast milk get tips on how to make the transition easier. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv weaning nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Storing Breast Milk Fri, 30 Nov 2007 13:25:12 -0800

Author: pregnancyshow
Added: Fri, 30 Nov 2007 13:25:12 -0800
Duration: 61

Properly storing your breast milk can make all the difference in how nutritious and health-boosting it is for your child. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/505520/mommys-minute-storing-breast-milk/ http://revver.com/watch/505520 Mommy's Minute - Storing Breast Milk Properly storing your breast milk can make all the difference in how nutritious and health-boosting it is for your child. Visit www.ThePregnancyShow.com Properly storing your breast milk can make all the difference in how nutritious and health-boosting it is for your child. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Preventing Hereditary Birth Defects Fri, 30 Nov 2007 13:25:12 -0800

Author: pregnancyshow
Added: Fri, 30 Nov 2007 13:25:12 -0800
Duration: 53

If you are at risk, speak with a genetic counselor. A genetic counselor will be able to assess your risk of having a baby with a genetic birth defect. To learn more about genetic counselors visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/505527/mommys-minute-preventing-hereditary-birth-defects/ http://revver.com/watch/505527 Mommy's Minute - Preventing Hereditary Birth Defects If you are at risk, speak with a genetic counselor. A genetic counselor will be able to assess your risk of having a baby with a genetic birth defect. To learn more about genetic counselors visit www.ThePregnancyShow.com If you are at risk, speak with a genetic counselor. A genetic counselor will be able to assess your risk of having a baby with a genetic birth defect. To learn more about genetic counselors visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Benefits and Risks Of Pregnancy Bed Rest Fri, 30 Nov 2007 13:04:08 -0800

Author: pregnancyshow
Added: Fri, 30 Nov 2007 13:04:08 -0800
Duration: 46

If you're having pregnancy complications and were prescribed bed rest then learn the benefits and risks you may be faced with. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnantresttelevisiontv http://revver.com/video/505505/mommys-minute-benefits-and-risks-of-pregnancy-bed-rest/ http://revver.com/watch/505505 Mommy's Minute - Benefits and Risks Of Pregnancy Bed Rest If you're having pregnancy complications and were prescribed bed rest then learn the benefits and risks you may be faced with. Visit www.ThePregnancyShow.com If you're having pregnancy complications and were prescribed bed rest then learn the benefits and risks you may be faced with. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant rest television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Women Who Should Not Breastfeed Fri, 30 Nov 2007 13:04:08 -0800

Author: pregnancyshow
Added: Fri, 30 Nov 2007 13:04:08 -0800
Duration: 55

Breastfeeding can be full of benefits for you and your baby. Unfortunately, for some women breastfeeding is not an option. There are common complications that can prevent a women from breastfeeding. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/505506/mommys-minute-women-who-should-not-breastfeed/ http://revver.com/watch/505506 Mommy's Minute - Women Who Should Not Breastfeed Breastfeeding can be full of benefits for you and your baby. Unfortunately, for some women breastfeeding is not an option. There are common complications that can prevent a women from breastfeeding. Visit www.ThePregnancyShow.com Breastfeeding can be full of benefits for you and your baby. Unfortunately, for some women breastfeeding is not an option. There are common complications that can prevent a women from breastfeeding. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Developing A Budget - Financially Planning For Your Baby Thu, 29 Nov 2007 11:22:06 -0800

Author: pregnancyshow
Added: Thu, 29 Nov 2007 11:22:06 -0800
Duration: 104

Our financial expert breaks down the costs, and provides great budgeting tips on how to save money and curb debt before your baby comes. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityfinancialinfertilitykidkidsmommymomsmothermothersplanningpregnancypregnanttelevisiontv http://revver.com/video/503979/developing-a-budget-financially-planning-for-your-baby/ http://revver.com/watch/503979 Developing A Budget - Financially Planning For Your Baby Our financial expert breaks down the costs, and provides great budgeting tips on how to save money and curb debt before your baby comes. Visit www.ThePregnancyShow.com Our financial expert breaks down the costs, and provides great budgeting tips on how to save money and curb debt before your baby comes. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility financial infertility kid kids mommy moms mother mothers planning pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Credit - Financially Planning For Your Baby Thu, 29 Nov 2007 11:22:06 -0800

Author: pregnancyshow
Added: Thu, 29 Nov 2007 11:22:06 -0800
Duration: 96

Our financial expert breaks down the costs, and provides great budgeting tips on how to save money and curb debt before your baby comes. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityfinancialinfertilitykidkidsmommymomsmothermothersplanningpregnancypregnanttelevisiontv http://revver.com/video/503986/credit-financially-planning-for-your-baby/ http://revver.com/watch/503986 Credit - Financially Planning For Your Baby Our financial expert breaks down the costs, and provides great budgeting tips on how to save money and curb debt before your baby comes. Visit www.ThePregnancyShow.com Our financial expert breaks down the costs, and provides great budgeting tips on how to save money and curb debt before your baby comes. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility financial infertility kid kids mommy moms mother mothers planning pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Investing - Financially Planning For Your Baby Thu, 29 Nov 2007 11:04:07 -0800

Author: pregnancyshow
Added: Thu, 29 Nov 2007 11:04:07 -0800
Duration: 113

Our financial expert breaks down the costs, and provides great budgeting tips on how to save money and curb debt before your baby comes. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityfinancialinfertilitykidkidsmommymomsmothermothersplanningpregnancypregnanttelevisiontv http://revver.com/video/503961/investing-financially-planning-for-your-baby/ http://revver.com/watch/503961 Investing - Financially Planning For Your Baby Our financial expert breaks down the costs, and provides great budgeting tips on how to save money and curb debt before your baby comes. Visit www.ThePregnancyShow.com Our financial expert breaks down the costs, and provides great budgeting tips on how to save money and curb debt before your baby comes. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility financial infertility kid kids mommy moms mother mothers planning pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Getting Started - Financially Planning For Your Baby Thu, 29 Nov 2007 11:04:07 -0800

Author: pregnancyshow
Added: Thu, 29 Nov 2007 11:04:07 -0800
Duration: 94

Our financial expert breaks down the costs, and provides great budgeting tips on how to save money and curb debt before your baby comes. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityfinancialinfertilitykidkidsmommymomsmothermothersplanningpregnancypregnanttelevisiontv http://revver.com/video/503970/getting-started-financially-planning-for-your-baby/ http://revver.com/watch/503970 Getting Started - Financially Planning For Your Baby Our financial expert breaks down the costs, and provides great budgeting tips on how to save money and curb debt before your baby comes. Visit www.ThePregnancyShow.com Our financial expert breaks down the costs, and provides great budgeting tips on how to save money and curb debt before your baby comes. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility financial infertility kid kids mommy moms mother mothers planning pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Monthly Expenses - Financially Planning For Your Baby Thu, 29 Nov 2007 10:43:06 -0800

Author: pregnancyshow
Added: Thu, 29 Nov 2007 10:43:06 -0800
Duration: 95

Our financial expert breaks down the costs, and provides great budgeting tips on how to save money and curb debt before your baby comes. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityfinancialinfertilitykidkidsmommymomsmothermothersplanningpregnancypregnanttelevisiontv http://revver.com/video/503956/monthly-expenses-financially-planning-for-your-baby/ http://revver.com/watch/503956 Monthly Expenses - Financially Planning For Your Baby Our financial expert breaks down the costs, and provides great budgeting tips on how to save money and curb debt before your baby comes. Visit www.ThePregnancyShow.com Our financial expert breaks down the costs, and provides great budgeting tips on how to save money and curb debt before your baby comes. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility financial infertility kid kids mommy moms mother mothers planning pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Saving Money - Financially Planning For Your Baby Thu, 29 Nov 2007 10:13:06 -0800

Author: pregnancyshow
Added: Thu, 29 Nov 2007 10:13:06 -0800
Duration: 119

Our financial expert breaks down the costs, you and provides great budgeting tips on how to save money and curb debt before your baby comes. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityfinancialinfertilitykidkidsmommymomsmothermothersplanningpregnancypregnanttelevisiontv http://revver.com/video/503893/saving-money-financially-planning-for-your-baby/ http://revver.com/watch/503893 Saving Money - Financially Planning For Your Baby Our financial expert breaks down the costs, you and provides great budgeting tips on how to save money and curb debt before your baby comes. Visit www.ThePregnancyShow.com Our financial expert breaks down the costs, you and provides great budgeting tips on how to save money and curb debt before your baby comes. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility financial infertility kid kids mommy moms mother mothers planning pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Overall Cost - Financially Planning For Your Baby Thu, 29 Nov 2007 10:13:06 -0800

Author: pregnancyshow
Added: Thu, 29 Nov 2007 10:13:06 -0800
Duration: 101

Our financial expert breaks down the costs, and provides great budgeting tips on how to save money and curb debt before your baby comes. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityfinancialinfertilitykidkidsmommymomsmothermothersplanningpregnancypregnanttelevisiontv http://revver.com/video/503901/overall-cost-financially-planning-for-your-baby/ http://revver.com/watch/503901 Overall Cost - Financially Planning For Your Baby Our financial expert breaks down the costs, and provides great budgeting tips on how to save money and curb debt before your baby comes. Visit www.ThePregnancyShow.com Our financial expert breaks down the costs, and provides great budgeting tips on how to save money and curb debt before your baby comes. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility financial infertility kid kids mommy moms mother mothers planning pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Preparing Your Child For Attending Birth Fri, 23 Nov 2007 15:25:10 -0800

Author: pregnancyshow
Added: Fri, 23 Nov 2007 15:25:10 -0800
Duration: 52

If you've chosen to have your child attend your birth get tips on how to prepare them for this wonderful and exciting experience. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/496095/preparing-your-child-for-attending-birth/ http://revver.com/watch/496095 Preparing Your Child For Attending Birth If you've chosen to have your child attend your birth get tips on how to prepare them for this wonderful and exciting experience. Visit www.ThePregnancyShow.com If you've chosen to have your child attend your birth get tips on how to prepare them for this wonderful and exciting experience. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Should Siblings Attend The Birth? Fri, 23 Nov 2007 15:25:10 -0800

Author: pregnancyshow
Added: Fri, 23 Nov 2007 15:25:10 -0800
Duration: 50

Learn the pros and cons to having your child attend your birth. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnantsiblingstelevisiontv http://revver.com/video/496096/mommys-minute-should-siblings-attend-the-birth/ http://revver.com/watch/496096 Mommy's Minute - Should Siblings Attend The Birth? Learn the pros and cons to having your child attend your birth. Visit www.ThePregnancyShow.com Learn the pros and cons to having your child attend your birth. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant siblings television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Tips on Buying a High Chair Fri, 23 Nov 2007 15:25:10 -0800

Author: pregnancyshow
Added: Fri, 23 Nov 2007 15:25:10 -0800
Duration: 55

Get important tips on what to look for when buying a high chair. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchairchildchildrenentertainmentexpectingfertilityhighinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/496101/mommys-minute-tips-on-buying-a-high-chair/ http://revver.com/watch/496101 Mommy's Minute - Tips on Buying a High Chair Get important tips on what to look for when buying a high chair. Visit www.ThePregnancyShow.com Get important tips on what to look for when buying a high chair. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding chair child children entertainment expecting fertility high infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Tips on Buying a High Chair Fri, 23 Nov 2007 15:25:10 -0800

Author: pregnancyshow
Added: Fri, 23 Nov 2007 15:25:10 -0800
Duration: 55

Get important tips on what to look for when buying a high chair. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchairchildchildrenentertainmentexpectingfertilityhighinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/496108/mommys-minute-tips-on-buying-a-high-chair/ http://revver.com/watch/496108 Mommy's Minute - Tips on Buying a High Chair Get important tips on what to look for when buying a high chair. Visit www.ThePregnancyShow.com Get important tips on what to look for when buying a high chair. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding chair child children entertainment expecting fertility high infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Support Needed For Newborn Fri, 23 Nov 2007 15:25:10 -0800

Author: pregnancyshow
Added: Fri, 23 Nov 2007 15:25:10 -0800
Duration: 48

If you've just had a baby, find out the right people you should seek out to help lend support. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnantsupporttelevisiontv http://revver.com/video/496112/mommys-minute-support-needed-for-newborn/ http://revver.com/watch/496112 Mommy's Minute - Support Needed For Newborn If you've just had a baby, find out the right people you should seek out to help lend support. Visit www.ThePregnancyShow.com If you've just had a baby, find out the right people you should seek out to help lend support. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant support television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Colic And Your Baby Fri, 23 Nov 2007 15:19:06 -0800

Author: pregnancyshow
Added: Fri, 23 Nov 2007 15:19:06 -0800
Duration: 44

Get tips on how to soothe a colicky baby. Visit www.ThePregnancyShow.com

]]> babiesbabybreastfedbreastfeedbreastfeedingchildchildrencolicentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnanttelevisiontv http://revver.com/video/496084/mommys-minute-colic-and-your-baby/ http://revver.com/watch/496084 Mommy's Minute - Colic And Your Baby Get tips on how to soothe a colicky baby. Visit www.ThePregnancyShow.com Get tips on how to soothe a colicky baby. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby breastfed breastfeed breastfeeding child children colic entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mommy's Minute - Kids And Bike Safety Fri, 23 Nov 2007 15:19:06 -0800

Author: pregnancyshow
Added: Fri, 23 Nov 2007 15:19:06 -0800
Duration: 48

Learn the importance of teaching your children about bike safety. Visit www.ThePregnancyShow.com

]]> babiesbabybikebreastfedbreastfeedbreastfeedingchildchildrenentertainmentexpectingfertilityinfertilitykidkidsmommymomsmothermotherspregnancypregnantsafetytelevisiontv http://revver.com/video/496089/mommys-minute-kids-and-bike-safety/ http://revver.com/watch/496089 Mommy's Minute - Kids And Bike Safety Learn the importance of teaching your children about bike safety. Visit www.ThePregnancyShow.com Learn the importance of teaching your children about bike safety. Visit www.ThePregnancyShow.com pregnancyshow pregnancyshow babies baby bike breastfed breastfeed breastfeeding child children entertainment expecting fertility infertility kid kids mommy moms mother mothers pregnancy pregnant safety television tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/