Videos by reasontv Videos by reasontv http://revver.com/u/reasontv/ http://revver.com webmaster@revver.com Too Big to Fail 2.0 - Anthony Randazzo on Obama Regulations Sat, 05 Sep 2009 10:52:36 -0800

Author: reasontv
Added: Sat, 05 Sep 2009 10:52:36 -0800
Duration: 0

As the one-year anniversary of TARP chugs into view, Reason.tv's Nick Gillespie sat down with Reason Foundation policy analyst Anthony Randazzo to look at the next round of comprehensive financial regulations being crafted in Washington, D.C. The short version? Get ready for government oversight of just about every burp, hiccup, and fart in the economic system, from payday loans to "systemic risk." Three major proposals are high on President Barack Obama's fall agenda and if pending legislation passes, says Randazzo, the government will create a multi-tiered system for identifying financial institutions that are explicitly "too big to fail." The likely result? Far less choice and innovation for consumers and industry alike, a slower and weaker recovery, and a huge bill for taxpayers. For more details, read Randazzo's new study, "The Future of Too Big To Fail and Bailouts." Approximately 9 minutes. Shot by Dan Hayes and Meredith Bragg and edited by Dan Hayes.

]]> agencyanthonybigconsumerelizabethfailfinancialgillespienickobamaprotectionrandazzoreasontvtotoowarren http://revver.com/video/1897323/too-big-to-fail-20-anthony-randazzo-on-obama-regulations/ http://revver.com/watch/1897323 Too Big to Fail 2.0 - Anthony Randazzo on Obama Regulations As the one-year anniversary of TARP chugs into view, Reason.tv's Nick Gillespie sat down with Reason Foundation policy analyst Anthony Randazzo to look at the next round of comprehensive financial regulations being crafted in Washington, D.C. The short version? Get ready for government oversight of just about every burp, hiccup, and fart in the economic system, from payday loans to "systemic risk." Three major proposals are high on President Barack Obama's fall agenda and if pending legislation passes, says Randazzo, the government will create a multi-tiered system for identifying financial institutions that are explicitly "too big to fail." The likely result? Far less choice and innovation for consumers and industry alike, a slower and weaker recovery, and a huge bill for taxpayers. For more details, read Randazzo's new study, "The Future of Too Big To Fail and Bailouts." Approximately 9 minutes. Shot by Dan Hayes and Meredith Bragg and edited by Dan Hayes. As the one-year anniversary of TARP chugs into view, Reason.tv's Nick Gillespie sat down with Reason Foundation policy analyst Anthony Randazzo to look at the next round of comprehensive financial regulations being crafted in Washington, D.C. The short version? Get ready for government oversight of just about every burp, hiccup, and fart in the economic system, from payday loans to "systemic risk." Three major proposals are high on President Barack Obama's fall agenda and if pending legislation passes, says Randazzo, the government will create a multi-tiered system for identifying financial institutions that are explicitly "too big to fail." The likely result? Far less choice and innovation for consumers and industry alike, a slower and weaker recovery, and a huge bill for taxpayers. For more details, read Randazzo's new study, "The Future of Too Big To Fail and Bailouts." Approximately 9 minutes. Shot by Dan Hayes and Meredith Bragg and edited by Dan Hayes. reasontv reasontv agency anthony big consumer elizabeth fail financial gillespie nick obama protection randazzo reasontv to too warren nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Todd Zywicki on the Consumer Financial Protection Agency Wed, 02 Sep 2009 19:50:37 -0800

Author: reasontv
Added: Wed, 02 Sep 2009 19:50:37 -0800
Duration: 0

The Obama administration and members of Congress are pushing legislation that will create a new agency, The Consumer Financial Protection Agency, whose job would be to simplify and police all manner of financial transactions, from what sorts of mortgages could be offered to what sort of credit cards would be in your wallet to whether Wall Street could create new ways of buying and selling stocks. Reason.tv's Nick Gillespie recently sat down with George Mason University law professor, Volokh Conspiracy blogger, and Mercatus Center scholar Todd Zywicki to get answers. "The agency is one of the centerpieces of the Obama regulatory reform act[s]," says Zywicki, "It goes far beyond how we've thought about consumer credit regulation for the past 30 or 40 years." More importantly, it will do nothing to address pernicious incentives that encouraged banks and consumers to take on more debt than was prudent.

]]> agencycfpaconsumerelizabethfinancialgeorgemasonmercatusobamaprotectionregulationtodduniversitywarrenzywicki http://revver.com/video/1892692/todd-zywicki-on-the-consumer-financial-protection-agency/ http://revver.com/watch/1892692 Todd Zywicki on the Consumer Financial Protection Agency The Obama administration and members of Congress are pushing legislation that will create a new agency, The Consumer Financial Protection Agency, whose job would be to simplify and police all manner of financial transactions, from what sorts of mortgages could be offered to what sort of credit cards would be in your wallet to whether Wall Street could create new ways of buying and selling stocks. Reason.tv's Nick Gillespie recently sat down with George Mason University law professor, Volokh Conspiracy blogger, and Mercatus Center scholar Todd Zywicki to get answers. "The agency is one of the centerpieces of the Obama regulatory reform act[s]," says Zywicki, "It goes far beyond how we've thought about consumer credit regulation for the past 30 or 40 years." More importantly, it will do nothing to address pernicious incentives that encouraged banks and consumers to take on more debt than was prudent. The Obama administration and members of Congress are pushing legislation that will create a new agency, The Consumer Financial Protection Agency, whose job would be to simplify and police all manner of financial transactions, from what sorts of mortgages could be offered to what sort of credit cards would be in your wallet to whether Wall Street could create new ways of buying and selling stocks. Reason.tv's Nick Gillespie recently sat down with George Mason University law professor, Volokh Conspiracy blogger, and Mercatus Center scholar Todd Zywicki to get answers. "The agency is one of the centerpieces of the Obama regulatory reform act[s]," says Zywicki, "It goes far beyond how we've thought about consumer credit regulation for the past 30 or 40 years." More importantly, it will do nothing to address pernicious incentives that encouraged banks and consumers to take on more debt than was prudent. reasontv reasontv agency cfpa consumer elizabeth financial george mason mercatus obama protection regulation todd university warren zywicki nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Daniel Hannan on YouTube, the NHS, & his "Plan for Britain Thu, 27 Aug 2009 15:57:26 -0800

Author: reasontv
Added: Thu, 27 Aug 2009 15:57:26 -0800
Duration: 0

Reason senior editor Michael C. Moynihan sits down with Daniel Hannan, the Milton Friedman-loving member of European Parliament representing South East England, to discuss his infamous showdown with Prime Minister Gordon Brown, his opinion of the British National Health Service, and what the Republicans could learn from the recent successes of Britain's Conservative Party. Hannan spoke at the Heritage Foundation in August. His talk can be viewed here. Hannan blogs for the Telegraph here.

]]> browndanielfoundationgordonhannanheritagemichaelmoynihanreasontv http://revver.com/video/1880957/daniel-hannan-on-youtube-the-nhs-his-plan-for-britain/ http://revver.com/watch/1880957 Daniel Hannan on YouTube, the NHS, & his "Plan for Britain Reason senior editor Michael C. Moynihan sits down with Daniel Hannan, the Milton Friedman-loving member of European Parliament representing South East England, to discuss his infamous showdown with Prime Minister Gordon Brown, his opinion of the British National Health Service, and what the Republicans could learn from the recent successes of Britain's Conservative Party. Hannan spoke at the Heritage Foundation in August. His talk can be viewed here. Hannan blogs for the Telegraph here. Reason senior editor Michael C. Moynihan sits down with Daniel Hannan, the Milton Friedman-loving member of European Parliament representing South East England, to discuss his infamous showdown with Prime Minister Gordon Brown, his opinion of the British National Health Service, and what the Republicans could learn from the recent successes of Britain's Conservative Party. Hannan spoke at the Heritage Foundation in August. His talk can be viewed here. Hannan blogs for the Telegraph here. reasontv reasontv brown daniel foundation gordon hannan heritage michael moynihan reasontv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Barack W. Obama? Sat, 28 Mar 2009 02:32:32 -0800

Author: reasontv
Added: Sat, 28 Mar 2009 02:32:32 -0800
Duration: 0

Were Obama's executive orders banning torture and closing down the prison at Guantanamo Bay, signed on his first two days in office, just a head fake? Were they designed to placate a certain segment of his base, while actually continuingor even expandingmany of Bush administration terrorism policies?

]]> afghanistanbushccheneymichaelmoynihanobamaonreasontvterrorwar http://revver.com/video/1561178/barack-w-obama/ http://revver.com/watch/1561178 Barack W. Obama? Were Obama's executive orders banning torture and closing down the prison at Guantanamo Bay, signed on his first two days in office, just a head fake? Were they designed to placate a certain segment of his base, while actually continuingor even expandingmany of Bush administration terrorism policies? Were Obama's executive orders banning torture and closing down the prison at Guantanamo Bay, signed on his first two days in office, just a head fake? Were they designed to placate a certain segment of his base, while actually continuingor even expandingmany of Bush administration terrorism policies? reasontv reasontv afghanistan bush c cheney michael moynihan obama on reasontv terror war nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ John B. Taylor on the Economic Bailout Fri, 20 Mar 2009 22:03:00 -0800

Author: reasontv
Added: Fri, 20 Mar 2009 22:03:00 -0800
Duration: 387

John B. Taylor, professor of economics at Stanford University, discusses his new book "Getting Off Track: How Government Actions and Interventions Caused, Prolonged, and Worsened the Financial Crisis."

]]> authorbailouteconomicsjohntaylor http://revver.com/video/1547909/john-b-taylor-on-the-economic-bailout/ http://revver.com/watch/1547909 John B. Taylor on the Economic Bailout John B. Taylor, professor of economics at Stanford University, discusses his new book "Getting Off Track: How Government Actions and Interventions Caused, Prolonged, and Worsened the Financial Crisis." John B. Taylor, professor of economics at Stanford University, discusses his new book "Getting Off Track: How Government Actions and Interventions Caused, Prolonged, and Worsened the Financial Crisis." reasontv reasontv author bailout economics john taylor nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Robert Poole on Obama's Transportation Policy Sun, 25 Jan 2009 22:35:34 -0800

Author: reasontv
Added: Sun, 25 Jan 2009 22:35:34 -0800
Duration: 339

Reason Foundation Director of Transporation Studies Robert Poole talks about the massive problems facing America's trucking and traffic infrastructure. As the Obama administration gets set to spend billions of dollars on "shovel-ready programs," green technologies, and more, how should it make the best decisions for travelers and truckers? Use market forces, counsels Poole, not political pressure and environmentalist ideology, to get America moving again. Approximately six minutes. Shot and edited by Dan Hayes; interview conducted by Nick Gillespie.

]]> foundationobamapolicypoolereasonreasontvroberttransportation http://revver.com/video/1455915/robert-poole-on-obamas-transportation-policy/ http://revver.com/watch/1455915 Robert Poole on Obama's Transportation Policy Reason Foundation Director of Transporation Studies Robert Poole talks about the massive problems facing America's trucking and traffic infrastructure. As the Obama administration gets set to spend billions of dollars on "shovel-ready programs," green technologies, and more, how should it make the best decisions for travelers and truckers? Use market forces, counsels Poole, not political pressure and environmentalist ideology, to get America moving again. Approximately six minutes. Shot and edited by Dan Hayes; interview conducted by Nick Gillespie. Reason Foundation Director of Transporation Studies Robert Poole talks about the massive problems facing America's trucking and traffic infrastructure. As the Obama administration gets set to spend billions of dollars on "shovel-ready programs," green technologies, and more, how should it make the best decisions for travelers and truckers? Use market forces, counsels Poole, not political pressure and environmentalist ideology, to get America moving again. Approximately six minutes. Shot and edited by Dan Hayes; interview conducted by Nick Gillespie. reasontv reasontv foundation obama policy poole reason reasontv robert transportation nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Obama's New New Deal Tue, 16 Dec 2008 19:52:38 -0800

Author: reasontv
Added: Tue, 16 Dec 2008 19:52:38 -0800
Duration: 245

On the cusp of a deep economic recession, and with a staggering amount of bailout money being offered to struggling industries, pundits and political advisers are advocating that the incoming Obama administration construct a new New Deal. But is the popular narrative about the old New Deal—that Keynesian economics and top-down planning rescued America from the Great Depression—accurate? Reason.tv's Michael C. Moynihan talks to UCLA economist Lee Ohanian, who argues in work written with colleague Harold Cole, that the New Deal's massive intervention into the economy actually prolonged the economic crisis by seven years.

]]> bailoutdealdepressioneconomyfdrmagazinemichaelmoynihannewobamareasonreasontvrecession http://revver.com/video/1384751/obamas-new-new-deal/ http://revver.com/watch/1384751 Obama's New New Deal On the cusp of a deep economic recession, and with a staggering amount of bailout money being offered to struggling industries, pundits and political advisers are advocating that the incoming Obama administration construct a new New Deal. But is the popular narrative about the old New Deal—that Keynesian economics and top-down planning rescued America from the Great Depression—accurate? Reason.tv's Michael C. Moynihan talks to UCLA economist Lee Ohanian, who argues in work written with colleague Harold Cole, that the New Deal's massive intervention into the economy actually prolonged the economic crisis by seven years. On the cusp of a deep economic recession, and with a staggering amount of bailout money being offered to struggling industries, pundits and political advisers are advocating that the incoming Obama administration construct a new New Deal. But is the popular narrative about the old New Deal—that Keynesian economics and top-down planning rescued America from the Great Depression—accurate? Reason.tv's Michael C. Moynihan talks to UCLA economist Lee Ohanian, who argues in work written with colleague Harold Cole, that the New Deal's massive intervention into the economy actually prolonged the economic crisis by seven years. reasontv reasontv bailout deal depression economy fdr magazine michael moynihan new obama reason reasontv recession nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ John Gartner - In Search of Bill Clinton Wed, 19 Nov 2008 19:31:42 -0800

Author: reasontv
Added: Wed, 19 Nov 2008 19:31:42 -0800
Duration: 424

Clinton biographer John Gartner talks about Clinton's sexual addiction, love for Monica Lewinsky, economic policy triumphs, and the real identity of the 42nd president's father.

]]> billclintongartnerhypomaniajohnmagazinereasonreasontv http://revver.com/video/1328406/john-gartner-in-search-of-bill-clinton/ http://revver.com/watch/1328406 John Gartner - In Search of Bill Clinton Clinton biographer John Gartner talks about Clinton's sexual addiction, love for Monica Lewinsky, economic policy triumphs, and the real identity of the 42nd president's father. Clinton biographer John Gartner talks about Clinton's sexual addiction, love for Monica Lewinsky, economic policy triumphs, and the real identity of the 42nd president's father. reasontv reasontv bill clinton gartner hypomania john magazine reason reasontv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Just Can't Quit: How Far Will Smoking Bans Go? Wed, 12 Nov 2008 20:39:40 -0800

Author: reasontv
Added: Wed, 12 Nov 2008 20:39:40 -0800
Duration: 488

ecently, the Bay Area city of Belmont passed a law that targets people who smoke in their own homes. “I’m pretty sure I still live in America,” says smoker and Belmont resident David Scott. But if Scott lights up once the new law takes effect in January, he might just get a visit from a police officer. The mayor who championed the new law declares, “It is our responsibility to take care of everyone!’ and a pro-ban councilmember who worries about smoke wafting into neighboring units compares smoking in an apartment to shooting a gun through the wall. Smoking is one of the worst things you can do to your body, but how dangerous is second-hand smoke? Are banners saving lives or battering science? Are they progressive champions or plunderers of property rights?

]]> bansbelmontcaliforniagillespiemagazinenickreasonreasontvsmoking http://revver.com/video/1313008/just-cant-quit-how-far-will-smoking-bans-go/ http://revver.com/watch/1313008 Just Can't Quit: How Far Will Smoking Bans Go? ecently, the Bay Area city of Belmont passed a law that targets people who smoke in their own homes. “I’m pretty sure I still live in America,” says smoker and Belmont resident David Scott. But if Scott lights up once the new law takes effect in January, he might just get a visit from a police officer. The mayor who championed the new law declares, “It is our responsibility to take care of everyone!’ and a pro-ban councilmember who worries about smoke wafting into neighboring units compares smoking in an apartment to shooting a gun through the wall. Smoking is one of the worst things you can do to your body, but how dangerous is second-hand smoke? Are banners saving lives or battering science? Are they progressive champions or plunderers of property rights? ecently, the Bay Area city of Belmont passed a law that targets people who smoke in their own homes. “I’m pretty sure I still live in America,” says smoker and Belmont resident David Scott. But if Scott lights up once the new law takes effect in January, he might just get a visit from a police officer. The mayor who championed the new law declares, “It is our responsibility to take care of everyone!’ and a pro-ban councilmember who worries about smoke wafting into neighboring units compares smoking in an apartment to shooting a gun through the wall. Smoking is one of the worst things you can do to your body, but how dangerous is second-hand smoke? Are banners saving lives or battering science? Are they progressive champions or plunderers of property rights? reasontv reasontv bans belmont california gillespie magazine nick reason reasontv smoking nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Former FEC Chairman on McCain and Campaign Finance Thu, 30 Oct 2008 18:55:27 -0800

Author: reasontv
Added: Thu, 30 Oct 2008 18:55:27 -0800
Duration: 599

Former head of the Federal Election Commission, now a law professor at Capital University, talks with reason.tv about how campaign finance laws punish political speech. And why John McCain won't shake Smith's hand.

]]> bradcampaignfecfeingoldfinancejohnlawmccainsmith http://revver.com/video/1289078/former-fec-chairman-on-mccain-and-campaign-finance/ http://revver.com/watch/1289078 Former FEC Chairman on McCain and Campaign Finance Former head of the Federal Election Commission, now a law professor at Capital University, talks with reason.tv about how campaign finance laws punish political speech. And why John McCain won't shake Smith's hand. Former head of the Federal Election Commission, now a law professor at Capital University, talks with reason.tv about how campaign finance laws punish political speech. And why John McCain won't shake Smith's hand. reasontv reasontv brad campaign fec feingold finance john law mccain smith nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ How to fix America's health insurance crisis Thu, 09 Oct 2008 12:34:09 -0800

Author: reasontv
Added: Thu, 09 Oct 2008 12:34:09 -0800
Duration: 464

Reason.tvs Nick Gillespie knows how to get coverage to at least half of the 45 million Americans who need it. Call it the Gillespie Plan: If you want health insurance, get some.

]]> carecareydrewhealthinsurancereasoncomreasontvreform http://revver.com/video/1232240/how-to-fix-americas-health-insurance-crisis/ http://revver.com/watch/1232240 How to fix America's health insurance crisis Reason.tvs Nick Gillespie knows how to get coverage to at least half of the 45 million Americans who need it. Call it the Gillespie Plan: If you want health insurance, get some. Reason.tvs Nick Gillespie knows how to get coverage to at least half of the 45 million Americans who need it. Call it the Gillespie Plan: If you want health insurance, get some. reasontv reasontv care carey drew health insurance reasoncom reasontv reform nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Obama Kids: Sing for Change (Pyongyang Remix) Tue, 07 Oct 2008 10:53:09 -0800

Author: reasontv
Added: Tue, 07 Oct 2008 10:53:09 -0800
Duration: 127

Sing for change! Sing for leaders both Dear and Great!

]]> barackchangeforkoreamagazinenorthobamapyongyangreasonreasontvsing http://revver.com/video/1213927/obama-kids-sing-for-change-pyongyang-remix/ http://revver.com/watch/1213927 Obama Kids: Sing for Change (Pyongyang Remix) Sing for change! Sing for leaders both Dear and Great! Sing for change! Sing for leaders both Dear and Great! reasontv reasontv barack change for korea magazine north obama pyongyang reason reasontv sing nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Johan Norberg vs. Naomi Klein and The Shock Doctrine Mon, 29 Sep 2008 16:34:19 -0800

Author: reasontv
Added: Mon, 29 Sep 2008 16:34:19 -0800
Duration: 531

Swedish author Johan Norberg sits down with reason.tv's Michael C. Moynihan to discuss Naomi Klein's diastrous yet popular polemic against the great free market economist Milton Friedman.

]]> doctrinejohankleinmichaelmoynihannaominorbergreasontvshock http://revver.com/video/1208603/johan-norberg-vs-naomi-klein-and-the-shock-doctrine/ http://revver.com/watch/1208603 Johan Norberg vs. Naomi Klein and The Shock Doctrine Swedish author Johan Norberg sits down with reason.tv's Michael C. Moynihan to discuss Naomi Klein's diastrous yet popular polemic against the great free market economist Milton Friedman. Swedish author Johan Norberg sits down with reason.tv's Michael C. Moynihan to discuss Naomi Klein's diastrous yet popular polemic against the great free market economist Milton Friedman. reasontv reasontv doctrine johan klein michael moynihan naomi norberg reasontv shock nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Second Life: A Virtual Frontier Thu, 11 Sep 2008 11:55:48 -0800

Author: reasontv
Added: Thu, 11 Sep 2008 11:55:48 -0800
Duration: 547

Drew Carey takes us on a guided tour of Second Life, a virtual world.

]]> avatarcareydrewfreelifemarketsmindsreasontvsecondvirtualworld http://revver.com/video/1168164/second-life-a-virtual-frontier/ http://revver.com/watch/1168164 Second Life: A Virtual Frontier Drew Carey takes us on a guided tour of Second Life, a virtual world. Drew Carey takes us on a guided tour of Second Life, a virtual world. reasontv reasontv avatar carey drew free life markets minds reasontv second virtual world nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Starbucks vs. the Little Guy Wed, 10 Sep 2008 17:55:42 -0800

Author: reasontv
Added: Wed, 10 Sep 2008 17:55:42 -0800
Duration: 233

Starbucks CEO Howard Schultz recently announced that the company would close 600 of its approximately 12,000 American stores in the coming year, sending 12,000 managers and baristas to the unemployment line. But as Starbucks contracts, many independent coffee shops are growing, beating the coffee giant in an upscale market it helped to create. As anti-corporate crusaders are now discovering, instead of advocating for legal prohibitions on chain stores or attempting to zone the offending businesses off of Main Street USA, mom-and-pop shops can successfully combat the coffee behemoth by using old-fashioned market competition. reason.tv's Michael C. Moynihan and Dan Hayes investigate.

]]> capitalismcorporategreedmagazinemicahaelmoynihanreasonstarbucks http://revver.com/video/1166891/starbucks-vs-the-little-guy/ http://revver.com/watch/1166891 Starbucks vs. the Little Guy Starbucks CEO Howard Schultz recently announced that the company would close 600 of its approximately 12,000 American stores in the coming year, sending 12,000 managers and baristas to the unemployment line. But as Starbucks contracts, many independent coffee shops are growing, beating the coffee giant in an upscale market it helped to create. As anti-corporate crusaders are now discovering, instead of advocating for legal prohibitions on chain stores or attempting to zone the offending businesses off of Main Street USA, mom-and-pop shops can successfully combat the coffee behemoth by using old-fashioned market competition. reason.tv's Michael C. Moynihan and Dan Hayes investigate. Starbucks CEO Howard Schultz recently announced that the company would close 600 of its approximately 12,000 American stores in the coming year, sending 12,000 managers and baristas to the unemployment line. But as Starbucks contracts, many independent coffee shops are growing, beating the coffee giant in an upscale market it helped to create. As anti-corporate crusaders are now discovering, instead of advocating for legal prohibitions on chain stores or attempting to zone the offending businesses off of Main Street USA, mom-and-pop shops can successfully combat the coffee behemoth by using old-fashioned market competition. reason.tv's Michael C. Moynihan and Dan Hayes investigate. reasontv reasontv capitalism corporate greed magazine micahael moynihan reason starbucks nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Seattle Police Chief Norm Stamper on Ending the Drug War Fri, 15 Aug 2008 15:54:31 -0800

Author: reasontv
Added: Fri, 15 Aug 2008 15:54:31 -0800
Duration: 592

Norm Stamper is a cop who saw it all during his 34 years on active duty. As police of Seattle from 1994 through 2000, he was in charge during violent World Trade Organization protests in the Emerald City. Stamper is the author of the Breaking Rank: A Top Cop's Expos of the Dark Side of American Policing (2005) and now works with Law Enforcement Against Prohibition (LEAP), a nonprofit created by former cops to "reduce the multitude of unintended harmful consequences resulting from fighting the war on drugs and to lessen the incidence of death, disease, crime, and addiction by ultimately ending drug prohibition."

]]> drugleapmagazinemarijuananormpolicereasonreasontvstamperwarweed http://revver.com/video/1111392/seattle-police-chief-norm-stamper-on-ending-the-drug-war/ http://revver.com/watch/1111392 Seattle Police Chief Norm Stamper on Ending the Drug War Norm Stamper is a cop who saw it all during his 34 years on active duty. As police of Seattle from 1994 through 2000, he was in charge during violent World Trade Organization protests in the Emerald City. Stamper is the author of the Breaking Rank: A Top Cop's Expos of the Dark Side of American Policing (2005) and now works with Law Enforcement Against Prohibition (LEAP), a nonprofit created by former cops to "reduce the multitude of unintended harmful consequences resulting from fighting the war on drugs and to lessen the incidence of death, disease, crime, and addiction by ultimately ending drug prohibition." Norm Stamper is a cop who saw it all during his 34 years on active duty. As police of Seattle from 1994 through 2000, he was in charge during violent World Trade Organization protests in the Emerald City. Stamper is the author of the Breaking Rank: A Top Cop's Expos of the Dark Side of American Policing (2005) and now works with Law Enforcement Against Prohibition (LEAP), a nonprofit created by former cops to "reduce the multitude of unintended harmful consequences resulting from fighting the war on drugs and to lessen the incidence of death, disease, crime, and addiction by ultimately ending drug prohibition." reasontv reasontv drug leap magazine marijuana norm police reason reasontv stamper war weed nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ GUILTY - A Verdict in the Charlie Lynch Case Thu, 07 Aug 2008 13:53:41 -0800

Author: reasontv
Added: Thu, 07 Aug 2008 13:53:41 -0800
Duration: 257

The jury has delivered a verdict in the trial of Charlie Lynch: Guilty on all counts. The former medical marijuana dispensary operator could very well receive a sentence much longer than the average sentence first-degree murderers receive. Hear from two of Lynch's defense attorneys, as well as the jury foreperson, in this video update produced by Ted Balaker and Rick Ray. Associate Producers are Seth Goldin and Brittney Bussian. Previous Lynch trial video updates can be found at www.reason.tv.

]]> charlielynchmagazinemarijuanamedicalreasonreasontv http://revver.com/video/1093710/guilty-a-verdict-in-the-charlie-lynch-case/ http://revver.com/watch/1093710 GUILTY - A Verdict in the Charlie Lynch Case The jury has delivered a verdict in the trial of Charlie Lynch: Guilty on all counts. The former medical marijuana dispensary operator could very well receive a sentence much longer than the average sentence first-degree murderers receive. Hear from two of Lynch's defense attorneys, as well as the jury foreperson, in this video update produced by Ted Balaker and Rick Ray. Associate Producers are Seth Goldin and Brittney Bussian. Previous Lynch trial video updates can be found at www.reason.tv. The jury has delivered a verdict in the trial of Charlie Lynch: Guilty on all counts. The former medical marijuana dispensary operator could very well receive a sentence much longer than the average sentence first-degree murderers receive. Hear from two of Lynch's defense attorneys, as well as the jury foreperson, in this video update produced by Ted Balaker and Rick Ray. Associate Producers are Seth Goldin and Brittney Bussian. Previous Lynch trial video updates can be found at www.reason.tv. reasontv reasontv charlie lynch magazine marijuana medical reason reasontv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Johan Norberg -Swedish Myths and Realities Wed, 06 Aug 2008 13:53:36 -0800

Author: reasontv
Added: Wed, 06 Aug 2008 13:53:36 -0800
Duration: 358

Johan Norberg, author of In Defense of Global Capitalism, sits down with reason.tv's Michael C. Moynihan to sort out the myths of the Sweden's welfare state, health services, tax rates, and its status as the "most successful society the world has ever known."

]]> cjohanmagazinemichaelmoynihannannynorbergreasonreasontvstatesweden http://revver.com/video/1091055/johan-norberg-swedish-myths-and-realities/ http://revver.com/watch/1091055 Johan Norberg -Swedish Myths and Realities Johan Norberg, author of In Defense of Global Capitalism, sits down with reason.tv's Michael C. Moynihan to sort out the myths of the Sweden's welfare state, health services, tax rates, and its status as the "most successful society the world has ever known." Johan Norberg, author of In Defense of Global Capitalism, sits down with reason.tv's Michael C. Moynihan to sort out the myths of the Sweden's welfare state, health services, tax rates, and its status as the "most successful society the world has ever known." reasontv reasontv c johan magazine michael moynihan nanny norberg reason reasontv state sweden nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Jason Riley - Let Them In: The Case for Open Borders Tue, 05 Aug 2008 16:34:13 -0800

Author: reasontv
Added: Tue, 05 Aug 2008 16:34:13 -0800
Duration: 310

The title of Jason L. Riley's new book helps explain why it has proven so controversial: Let Them In: The Case for Open Borders. Let Them In is as exhaustively researched as it is eminently readable, Riley, a member of The Wall Street Journal's editorial board runs through all the anti-immigration arguments at play in today's heated political worldand finds them wanting. Earlier this summer, Riley sat down earlier this summer with reason.tv's Nick Gillespie to discuss the leading myths about the causes and effects of immigration.

]]> boardborderseditorialgillespieimmigrationjasonjournallmagazinenickopenreasonreasontvrileystreetwall http://revver.com/video/1085658/jason-riley-let-them-in-the-case-for-open-borders/ http://revver.com/watch/1085658 Jason Riley - Let Them In: The Case for Open Borders The title of Jason L. Riley's new book helps explain why it has proven so controversial: Let Them In: The Case for Open Borders. Let Them In is as exhaustively researched as it is eminently readable, Riley, a member of The Wall Street Journal's editorial board runs through all the anti-immigration arguments at play in today's heated political worldand finds them wanting. Earlier this summer, Riley sat down earlier this summer with reason.tv's Nick Gillespie to discuss the leading myths about the causes and effects of immigration. The title of Jason L. Riley's new book helps explain why it has proven so controversial: Let Them In: The Case for Open Borders. Let Them In is as exhaustively researched as it is eminently readable, Riley, a member of The Wall Street Journal's editorial board runs through all the anti-immigration arguments at play in today's heated political worldand finds them wanting. Earlier this summer, Riley sat down earlier this summer with reason.tv's Nick Gillespie to discuss the leading myths about the causes and effects of immigration. reasontv reasontv board borders editorial gillespie immigration jason journal l magazine nick open reason reasontv riley street wall nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Silencing Owen: Charlie Lynch Trial Update Thu, 31 Jul 2008 17:53:02 -0800

Author: reasontv
Added: Thu, 31 Jul 2008 17:53:02 -0800
Duration: 133

After armed federal agents raided his dispensary in 2007, Lynch now finds himself in the midst of a trial that could land him in prison for the rest of his life. On Tuesday Owen Beck was called to the stand to speak on Lynchs behalfand then promptly silenced. In this video update, reason.tv continues its coverage of the saga first told in the documentary short, Raiding California: Medical Marijuana and Minors.

]]> charlielynchmagazinemarijuanamedicalreasonreasontv http://revver.com/video/1076880/silencing-owen-charlie-lynch-trial-update/ http://revver.com/watch/1076880 Silencing Owen: Charlie Lynch Trial Update After armed federal agents raided his dispensary in 2007, Lynch now finds himself in the midst of a trial that could land him in prison for the rest of his life. On Tuesday Owen Beck was called to the stand to speak on Lynchs behalfand then promptly silenced. In this video update, reason.tv continues its coverage of the saga first told in the documentary short, Raiding California: Medical Marijuana and Minors. After armed federal agents raided his dispensary in 2007, Lynch now finds himself in the midst of a trial that could land him in prison for the rest of his life. On Tuesday Owen Beck was called to the stand to speak on Lynchs behalfand then promptly silenced. In this video update, reason.tv continues its coverage of the saga first told in the documentary short, Raiding California: Medical Marijuana and Minors. reasontv reasontv charlie lynch magazine marijuana medical reason reasontv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Earmarks: The Alien Menace Tue, 29 Jul 2008 13:52:47 -0800

Author: reasontv
Added: Tue, 29 Jul 2008 13:52:47 -0800
Duration: 338

Taxpayers are shelling out over $17 billion for more than 11,000 Congressional pork projects in FY 2008.

]]> appropriationscareycoburndeficitdrewearmarksgillespienickporkreasoncomreasontvspendingtom http://revver.com/video/1072076/earmarks-the-alien-menace/ http://revver.com/watch/1072076 Earmarks: The Alien Menace Taxpayers are shelling out over $17 billion for more than 11,000 Congressional pork projects in FY 2008. Taxpayers are shelling out over $17 billion for more than 11,000 Congressional pork projects in FY 2008. reasontv reasontv appropriations carey coburn deficit drew earmarks gillespie nick pork reasoncom reasontv spending tom nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ MCCAIN'S BIG CASH PRIZE Fri, 25 Jul 2008 10:55:24 -0800

Author: reasontv
Added: Fri, 25 Jul 2008 10:55:24 -0800
Duration: 125

Paying $4 for a gallon of gas is a drag, but what may be worse is listening to White House wannabes who promise to rescue us from our misery. Take Senator McCains recent proposal to offer a $300 million cash prize to the inventor of a car battery that can out-green 100-mpg plug-in hybrids. Is McCains money pile really necessary to spur our nations geniuses to get it together and invent an ultra-efficient car? reason.tvs Ted Balaker thinks not.

]]> bigcashmccainsprizereasontv http://revver.com/video/1064784/mccains-big-cash-prize/ http://revver.com/watch/1064784 MCCAIN'S BIG CASH PRIZE Paying $4 for a gallon of gas is a drag, but what may be worse is listening to White House wannabes who promise to rescue us from our misery. Take Senator McCains recent proposal to offer a $300 million cash prize to the inventor of a car battery that can out-green 100-mpg plug-in hybrids. Is McCains money pile really necessary to spur our nations geniuses to get it together and invent an ultra-efficient car? reason.tvs Ted Balaker thinks not. Paying $4 for a gallon of gas is a drag, but what may be worse is listening to White House wannabes who promise to rescue us from our misery. Take Senator McCains recent proposal to offer a $300 million cash prize to the inventor of a car battery that can out-green 100-mpg plug-in hybrids. Is McCains money pile really necessary to spur our nations geniuses to get it together and invent an ultra-efficient car? reason.tvs Ted Balaker thinks not. reasontv reasontv big cash mccains prize reasontv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mark Bauerlein - Young Americans Are the Dumbest Generation Wed, 23 Jul 2008 10:31:15 -0800

Author: reasontv
Added: Wed, 23 Jul 2008 10:31:15 -0800
Duration: 495

In his provocative new book The Dumbest Generation, Mark Bauerlein argues that "the digital age stupefies young Americans and jeopardizes our future" by turning out hyper-networked kids who can track each other's every move with ease but are largely ignorant of history, economics, culture, and other subjects he believes are prerequisites for meaningful civic participation.

]]> bauerleindumbestgenerationgillespiemagazinemarknickreasonreasontv http://revver.com/video/1059573/mark-bauerlein-young-americans-are-the-dumbest-generation/ http://revver.com/watch/1059573 Mark Bauerlein - Young Americans Are the Dumbest Generation In his provocative new book The Dumbest Generation, Mark Bauerlein argues that "the digital age stupefies young Americans and jeopardizes our future" by turning out hyper-networked kids who can track each other's every move with ease but are largely ignorant of history, economics, culture, and other subjects he believes are prerequisites for meaningful civic participation. In his provocative new book The Dumbest Generation, Mark Bauerlein argues that "the digital age stupefies young Americans and jeopardizes our future" by turning out hyper-networked kids who can track each other's every move with ease but are largely ignorant of history, economics, culture, and other subjects he believes are prerequisites for meaningful civic participation. reasontv reasontv bauerlein dumbest generation gillespie magazine mark nick reason reasontv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ CAPTAIN KIRK TO BROTHER JED Wed, 16 Jul 2008 08:35:16 -0800

Author: reasontv
Added: Wed, 16 Jul 2008 08:35:16 -0800
Duration: 459

Director Roger Nygard on Trekkies,The Office, and confrontational evangelism.

]]> balakermagazinenygardreasonreasontvrogerted http://revver.com/video/1042321/captain-kirk-to-brother-jed/ http://revver.com/watch/1042321 CAPTAIN KIRK TO BROTHER JED Director Roger Nygard on Trekkies,The Office, and confrontational evangelism. Director Roger Nygard on Trekkies,The Office, and confrontational evangelism. reasontv reasontv balaker magazine nygard reason reasontv roger ted nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Banned: Welcome to Nanny State Nation Wed, 09 Jul 2008 17:36:44 -0800

Author: reasontv
Added: Wed, 09 Jul 2008 17:36:44 -0800
Duration: 227

Whether you love it, hate it, or have never thought about it, chances are some politician wants to ban it. \"Welcome to the Nanny State Nation,\" says reason.tv host Drew Carey. \"Where the government minds your own business.\"

]]> banbannedbulbscareydrewfatslightnannypantspokersaggysmokingstatetrans http://revver.com/video/1026538/banned-welcome-to-nanny-state-nation/ http://revver.com/watch/1026538 Banned: Welcome to Nanny State Nation Whether you love it, hate it, or have never thought about it, chances are some politician wants to ban it. \"Welcome to the Nanny State Nation,\" says reason.tv host Drew Carey. \"Where the government minds your own business.\" Whether you love it, hate it, or have never thought about it, chances are some politician wants to ban it. \"Welcome to the Nanny State Nation,\" says reason.tv host Drew Carey. \"Where the government minds your own business.\" reasontv reasontv ban banned bulbs carey drew fats light nanny pants poker saggy smoking state trans nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Jerome Tuccille - Rand, Rothbard and the LP's Big Moment Mon, 07 Jul 2008 16:25:11 -0800

Author: reasontv
Added: Mon, 07 Jul 2008 16:25:11 -0800
Duration: 291

In 1972, Jerome Tuccille published It Usually Begins With Ayn Rand, his memoir of the libertarian movement in the late 1960s and early 1970s. Palling around with the likes of economist Murray Rothbard, former Goldwater speechwriter Karl Hess, and ...

]]> aynjeromemagazinemurrayrandreasonreason.tvrothbardtuccille http://revver.com/video/1021027/jerome-tuccille-rand-rothbard-and-the-lp39s-big-moment/ http://revver.com/watch/1021027 Jerome Tuccille - Rand, Rothbard and the LP's Big Moment In 1972, Jerome Tuccille published It Usually Begins With Ayn Rand, his memoir of the libertarian movement in the late 1960s and early 1970s. Palling around with the likes of economist Murray Rothbard, former Goldwater speechwriter Karl Hess, and ... In 1972, Jerome Tuccille published It Usually Begins With Ayn Rand, his memoir of the libertarian movement in the late 1960s and early 1970s. Palling around with the likes of economist Murray Rothbard, former Goldwater speechwriter Karl Hess, and ... reasontv reasontv ayn jerome magazine murray rand reason reason.tv rothbard tuccille nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Marty Klein: Author of America's War on Sex Thu, 03 Jul 2008 15:22:56 -0800

Author: reasontv
Added: Thu, 03 Jul 2008 15:22:56 -0800
Duration: 257

reason.tv recently caught up with author Marty Klein to chat about his book America's War on Sex: The Attack on Law, Lust and Liberty. \"Our glorious Constitution,\" says Klein, a certified sex therapist and frequent expert witness in anti-censorship ...

]]> americaskleinmartyonreasonreason.tvsexwar http://revver.com/video/1011952/marty-klein-author-of-america39s-war-on-sex/ http://revver.com/watch/1011952 Marty Klein: Author of America's War on Sex reason.tv recently caught up with author Marty Klein to chat about his book America's War on Sex: The Attack on Law, Lust and Liberty. \"Our glorious Constitution,\" says Klein, a certified sex therapist and frequent expert witness in anti-censorship ... reason.tv recently caught up with author Marty Klein to chat about his book America's War on Sex: The Attack on Law, Lust and Liberty. \"Our glorious Constitution,\" says Klein, a certified sex therapist and frequent expert witness in anti-censorship ... reasontv reasontv americas klein marty on reason reason.tv sex war nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Clay Epstein: Censorship and Slashers Thu, 03 Jul 2008 11:47:01 -0800

Author: reasontv
Added: Thu, 03 Jul 2008 11:47:01 -0800
Duration: 432

reason.tv’s Ted Balaker sits down with independent movie producer Clay Epstein of The Little Film Company to discuss the cultural, political, and aesthetic complexities of the international film market. The Little Film Company's credits include An ...

]]> balakerclayepsteinmovieproducerreasonreason.tvtedtsotsi http://revver.com/video/1009251/clay-epstein-censorship-and-slashers/ http://revver.com/watch/1009251 Clay Epstein: Censorship and Slashers reason.tv’s Ted Balaker sits down with independent movie producer Clay Epstein of The Little Film Company to discuss the cultural, political, and aesthetic complexities of the international film market. The Little Film Company's credits include An ... reason.tv’s Ted Balaker sits down with independent movie producer Clay Epstein of The Little Film Company to discuss the cultural, political, and aesthetic complexities of the international film market. The Little Film Company's credits include An ... reasontv reasontv balaker clay epstein movie producer reason reason.tv ted tsotsi nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mexicans and Machines: Drew Carey on Nafta Wed, 25 Jun 2008 07:49:56 -0800

Author: reasontv
Added: Wed, 25 Jun 2008 07:49:56 -0800
Duration: 449

Drew Carey and Reason.tv on Nafta

]]> careydrewfreejobsmarketsmindsnaftatechnology http://revver.com/video/989203/mexicans-and-machines-drew-carey-on-nafta/ http://revver.com/watch/989203 Mexicans and Machines: Drew Carey on Nafta Drew Carey and Reason.tv on Nafta Drew Carey and Reason.tv on Nafta reasontv reasontv carey drew free jobs markets minds nafta technology nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Drew Carey and Reason.tv Wed, 11 Jun 2008 10:21:07 -0800

Author: reasontv
Added: Wed, 11 Jun 2008 10:21:07 -0800
Duration: 600

Reason.tv and Drew Carey - Raiding California: Medical Marijuana and Minors

]]> californiacareycharliedrewdrugdrugslibertarianlynchmarijuanamedicalpolicyreason.tv http://revver.com/video/950753/drew-carey-and-reasontv/ http://revver.com/watch/950753 Drew Carey and Reason.tv Reason.tv and Drew Carey - Raiding California: Medical Marijuana and Minors Reason.tv and Drew Carey - Raiding California: Medical Marijuana and Minors reasontv reasontv california carey charlie drew drug drugs libertarian lynch marijuana medical policy reason.tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ The Wall (Part 2 of 2) Wed, 28 May 2008 11:22:38 -0800

Author: reasontv
Added: Wed, 28 May 2008 11:22:38 -0800
Duration: 331

Reason.tv and Drew Carey - The Wall: The Cost of Securing Our Southern Border. (Part 2 of 2)

]]> bordercareydrewimmigrationreasontv http://revver.com/video/917825/the-wall-part-2-of-2/ http://revver.com/watch/917825 The Wall (Part 2 of 2) Reason.tv and Drew Carey - The Wall: The Cost of Securing Our Southern Border. (Part 2 of 2) Reason.tv and Drew Carey - The Wall: The Cost of Securing Our Southern Border. (Part 2 of 2) reasontv reasontv border carey drew immigration reasontv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ The Wall (Part 2 of 2) Wed, 28 May 2008 10:16:22 -0800

Author: reasontv
Added: Wed, 28 May 2008 10:16:22 -0800
Duration: 331

Reason.tv and Drew Carey - The Wall: The Cost of Securing Our Southern Border. (Part 2 of 2)

]]> bordercareydrewimmigrationreasontv http://revver.com/video/917667/the-wall-part-2-of-2/ http://revver.com/watch/917667 The Wall (Part 2 of 2) Reason.tv and Drew Carey - The Wall: The Cost of Securing Our Southern Border. (Part 2 of 2) Reason.tv and Drew Carey - The Wall: The Cost of Securing Our Southern Border. (Part 2 of 2) reasontv reasontv border carey drew immigration reasontv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ The Wall (Part 1 of 2) Wed, 28 May 2008 07:31:43 -0800

Author: reasontv
Added: Wed, 28 May 2008 07:31:43 -0800
Duration: 324

Reason.tv and Drew Carey - The Wall: The Cost of Securing Our Southern Border. (Part 1 of 2)

]]> bordercareydrewimmigrationreasontvwall http://revver.com/video/917254/the-wall-part-1-of-2/ http://revver.com/watch/917254 The Wall (Part 1 of 2) Reason.tv and Drew Carey - The Wall: The Cost of Securing Our Southern Border. (Part 1 of 2) Reason.tv and Drew Carey - The Wall: The Cost of Securing Our Southern Border. (Part 1 of 2) reasontv reasontv border carey drew immigration reasontv wall nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mississippi Drug War Blues (Part 1 of 3) Thu, 08 May 2008 00:19:32 -0800

Author: reasontv
Added: Thu, 08 May 2008 00:19:32 -0800
Duration: 567

Drew Carey and Reason.tv on the Cory Maye case.

]]> careycivilcorydrewdrugslibertarianlibertiesmayeonpoliceraidsreason.comreason.tvswatwar http://revver.com/video/871276/mississippi-drug-war-blues-part-1-of-3/ http://revver.com/watch/871276 Mississippi Drug War Blues (Part 1 of 3) Drew Carey and Reason.tv on the Cory Maye case. Drew Carey and Reason.tv on the Cory Maye case. reasontv reasontv carey civil cory drew drugs libertarian liberties maye on police raids reason.com reason.tv swat war nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mississippi Drug War Blues (Part 2 of 3) Thu, 08 May 2008 00:19:32 -0800

Author: reasontv
Added: Thu, 08 May 2008 00:19:32 -0800
Duration: 425

Drew Carey and Reason.tv on the Cory Maye case.

]]> careycivilcorydrewdrugslibertarianlibertiesmayeonpoliceraidsreason.comreason.tvswatwar http://revver.com/video/871279/mississippi-drug-war-blues-part-2-of-3/ http://revver.com/watch/871279 Mississippi Drug War Blues (Part 2 of 3) Drew Carey and Reason.tv on the Cory Maye case. Drew Carey and Reason.tv on the Cory Maye case. reasontv reasontv carey civil cory drew drugs libertarian liberties maye on police raids reason.com reason.tv swat war nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mississippi Drug War Blues (Part 3 of 3) Thu, 08 May 2008 00:19:32 -0800

Author: reasontv
Added: Thu, 08 May 2008 00:19:32 -0800
Duration: 508

Drew Carey and Reason.tv on the Cory Maye case.

]]> careycivilcorydrewdrugslibertarianlibertiesmayeonpoliceraidsreason.comreason.tvswatwar http://revver.com/video/871280/mississippi-drug-war-blues-part-3-of-3/ http://revver.com/watch/871280 Mississippi Drug War Blues (Part 3 of 3) Drew Carey and Reason.tv on the Cory Maye case. Drew Carey and Reason.tv on the Cory Maye case. reasontv reasontv carey civil cory drew drugs libertarian liberties maye on police raids reason.com reason.tv swat war nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Drew Carey and Reason.tv - Battle of the Bacon Dogs Fri, 25 Apr 2008 13:19:33 -0800

Author: reasontv
Added: Fri, 25 Apr 2008 13:19:33 -0800
Duration: 408

In \"Food Fight: Battle of the Bacon Dogs,\" reason.tv host Drew Carey takes a long look at the human cost of trying to prohibit trade in oh-so-tasty treats.

]]> angelesbaconcareydogsdrewfoodlosnannyreason.tvstate http://revver.com/video/844022/drew-carey-and-reasontv-battle-of-the-bacon-dogs/ http://revver.com/watch/844022 Drew Carey and Reason.tv - Battle of the Bacon Dogs In \"Food Fight: Battle of the Bacon Dogs,\" reason.tv host Drew Carey takes a long look at the human cost of trying to prohibit trade in oh-so-tasty treats. In \"Food Fight: Battle of the Bacon Dogs,\" reason.tv host Drew Carey takes a long look at the human cost of trying to prohibit trade in oh-so-tasty treats. reasontv reasontv angeles bacon carey dogs drew food los nanny reason.tv state nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Drew Carey and Reason.tv on Immigration: The Beckham Factor Mon, 31 Mar 2008 22:16:16 -0800

Author: reasontv
Added: Mon, 31 Mar 2008 22:16:16 -0800
Duration: 283

Drew Carey and Reason.tv on Immigration: The Beckham Factor

]]> beckhamcareydrewfootballimmigrationlibertarianreason.comreason.tvsoccer http://revver.com/video/781401/drew-carey-and-reasontv-on-immigration-the-beckham-factor/ http://revver.com/watch/781401 Drew Carey and Reason.tv on Immigration: The Beckham Factor Drew Carey and Reason.tv on Immigration: The Beckham Factor Drew Carey and Reason.tv on Immigration: The Beckham Factor reasontv reasontv beckham carey drew football immigration libertarian reason.com reason.tv soccer nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Kidneys For Sale? Tue, 18 Mar 2008 05:16:17 -0800

Author: reasontv
Added: Tue, 18 Mar 2008 05:16:17 -0800
Duration: 586

Each year more than 3,000 Americans die waiting for kidney transplants. Drew Carey explores how to help end the wait and save lives.

]]> careydonationsdrewkidneysorganreason.comreason.tvtransplants http://revver.com/video/751916/kidneys-for-sale/ http://revver.com/watch/751916 Kidneys For Sale? Each year more than 3,000 Americans die waiting for kidney transplants. Drew Carey explores how to help end the wait and save lives. Each year more than 3,000 Americans die waiting for kidney transplants. Drew Carey explores how to help end the wait and save lives. reasontv reasontv carey donations drew kidneys organ reason.com reason.tv transplants nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Education Revolt in Watts, by Drew Carey and Reason.tv Mon, 18 Feb 2008 21:55:37 -0800

Author: reasontv
Added: Mon, 18 Feb 2008 21:55:37 -0800
Duration: 598

Drew Carey goes to Locke High School in Watts to examine the charter school education revolt that’s erupting across the nation.

]]> careycharterdreweducationreason.comreason.tvschools http://revver.com/video/689124/education-revolt-in-watts-by-drew-carey-and-reasontv/ http://revver.com/watch/689124 Education Revolt in Watts, by Drew Carey and Reason.tv Drew Carey goes to Locke High School in Watts to examine the charter school education revolt that’s erupting across the nation. Drew Carey goes to Locke High School in Watts to examine the charter school education revolt that’s erupting across the nation. reasontv reasontv carey charter drew education reason.com reason.tv schools nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Living Large, by Drew Carey and Reason.tv Mon, 04 Feb 2008 02:16:21 -0800

Author: reasontv
Added: Mon, 04 Feb 2008 02:16:21 -0800
Duration: 450

Drew Carey and Reason.tv examine the plight of the American middle class.

]]> careyclassclintondobbsdreweconomicsfreelibertarianloumarketsmccainmiddlemindsobamareason.comreason.tvromney http://revver.com/video/655664/living-large-by-drew-carey-and-reasontv/ http://revver.com/watch/655664 Living Large, by Drew Carey and Reason.tv Drew Carey and Reason.tv examine the plight of the American middle class. Drew Carey and Reason.tv examine the plight of the American middle class. reasontv reasontv carey class clinton dobbs drew economics free libertarian lou markets mccain middle minds obama reason.com reason.tv romney nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Dance Ban: Footloose in Arizona Tue, 15 Jan 2008 21:06:41 -0800

Author: reasontv
Added: Tue, 15 Jan 2008 21:06:41 -0800
Duration: 388

In the Arizona desert, Drew Carey discovers a modern-day \"Footloose\" story. A few years ago, Dale and Spencer Bell built a family oriented steak house with outdoor seating, fire pits, lots of old western style, and live music. But beware if you get ...

]]> bancareycountydancedancingdrewflatfootloosepinalpropertyreason.comreason.tvregulationrightssantanzoning http://revver.com/video/618960/dance-ban-footloose-in-arizona/ http://revver.com/watch/618960 Dance Ban: Footloose in Arizona In the Arizona desert, Drew Carey discovers a modern-day \"Footloose\" story. A few years ago, Dale and Spencer Bell built a family oriented steak house with outdoor seating, fire pits, lots of old western style, and live music. But beware if you get ... In the Arizona desert, Drew Carey discovers a modern-day \"Footloose\" story. A few years ago, Dale and Spencer Bell built a family oriented steak house with outdoor seating, fire pits, lots of old western style, and live music. But beware if you get ... reasontv reasontv ban carey county dance dancing drew flat footloose pinal property reason.com reason.tv regulation rights san tan zoning nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Christopher Hitchens: Bah, Humbug on Christmas Wed, 19 Dec 2007 14:04:08 -0800

Author: reasontv
Added: Wed, 19 Dec 2007 14:04:08 -0800
Duration: 177

On Monday, December 17, reason hosted a "Very Special, Very Secular Christmas Party" at its Washington, D.C. headquarters.

]]> carolchristmaschristopherhitchenslehrermagazinepartyreasontom http://revver.com/video/576863/christopher-hitchens-bah-humbug-on-christmas/ http://revver.com/watch/576863 Christopher Hitchens: Bah, Humbug on Christmas On Monday, December 17, reason hosted a "Very Special, Very Secular Christmas Party" at its Washington, D.C. headquarters. On Monday, December 17, reason hosted a "Very Special, Very Secular Christmas Party" at its Washington, D.C. headquarters. reasontv reasontv carol christmas christopher hitchens lehrer magazine party reason tom nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Redevelopment: A Tale Of Two Cities Mon, 17 Dec 2007 18:58:06 -0800

Author: reasontv
Added: Mon, 17 Dec 2007 18:58:06 -0800
Duration: 608

The latest Reason.tv video hosted by Drew Carey shows the government stealing land in Hollywood to give to wealthy developers, and explains how Anaheim Mayor Curt Pringle has a better approach to redevelopment.

]]> careydomaindreweminentpropertyreason.comreason.tvrights http://revver.com/video/533186/redevelopment-a-tale-of-two-cities/ http://revver.com/watch/533186 Redevelopment: A Tale Of Two Cities The latest Reason.tv video hosted by Drew Carey shows the government stealing land in Hollywood to give to wealthy developers, and explains how Anaheim Mayor Curt Pringle has a better approach to redevelopment. The latest Reason.tv video hosted by Drew Carey shows the government stealing land in Hollywood to give to wealthy developers, and explains how Anaheim Mayor Curt Pringle has a better approach to redevelopment. reasontv reasontv carey domain drew eminent property reason.com reason.tv rights nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Texas Close 'Em by Drew Carey and Reason.tv Mon, 03 Dec 2007 03:55:14 -0800

Author: reasontv
Added: Mon, 03 Dec 2007 03:55:14 -0800
Duration: 310

Drew Carey reports on the paramilitary-style raid by police on a poker game at a Dallas VFW post, which has been forced to close its doors. Visit Reason.tv.

]]> careydrewfreedomgamblingpokerreasonreason.comreason.tvveteransvfw http://revver.com/video/508549/texas-close-em-by-drew-carey-and-reasontv/ http://revver.com/watch/508549 Texas Close 'Em by Drew Carey and Reason.tv Drew Carey reports on the paramilitary-style raid by police on a poker game at a Dallas VFW post, which has been forced to close its doors. Visit Reason.tv. Drew Carey reports on the paramilitary-style raid by police on a poker game at a Dallas VFW post, which has been forced to close its doors. Visit Reason.tv. reasontv reasontv carey drew freedom gambling poker reason reason.com reason.tv veterans vfw nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Medical Marijuana by Drew Carey and Reason.tv Thu, 15 Nov 2007 06:58:07 -0800

Author: reasontv
Added: Thu, 15 Nov 2007 06:58:07 -0800
Duration: 644

In Episode 2 of The Drew Carey Project at Reason.tv, Drew takes a look at patients who need and use medical marijuana in California, and how the federal government is making their lives even worse. Visit www.reason.tv for more.

]]> careydeadrewlibertarianmagazinemarijuanapoliticsreasonreason.comreason.tv http://revver.com/video/485395/medical-marijuana-by-drew-carey-and-reasontv/ http://revver.com/watch/485395 Medical Marijuana by Drew Carey and Reason.tv In Episode 2 of The Drew Carey Project at Reason.tv, Drew takes a look at patients who need and use medical marijuana in California, and how the federal government is making their lives even worse. Visit www.reason.tv for more. In Episode 2 of The Drew Carey Project at Reason.tv, Drew takes a look at patients who need and use medical marijuana in California, and how the federal government is making their lives even worse. Visit www.reason.tv for more. reasontv reasontv carey dea drew libertarian magazine marijuana politics reason reason.com reason.tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Eminent Domain Gone Wild, by Drew Carey and Reason.tv Wed, 14 Nov 2007 23:25:10 -0800

Author: reasontv
Added: Wed, 14 Nov 2007 23:25:10 -0800
Duration: 679

Reason.tv host Drew Carey visits National City, California, where the local government is taking eminent domain abuse to new lows. (Episode 3) Visit www.reason.tv.

]]> careydomaindreweminentlibertarianmagazinepropertyreasonreason.comreason.orgreason.tvrights http://revver.com/video/484838/eminent-domain-gone-wild-by-drew-carey-and-reasontv/ http://revver.com/watch/484838 Eminent Domain Gone Wild, by Drew Carey and Reason.tv Reason.tv host Drew Carey visits National City, California, where the local government is taking eminent domain abuse to new lows. (Episode 3) Visit www.reason.tv. Reason.tv host Drew Carey visits National City, California, where the local government is taking eminent domain abuse to new lows. (Episode 3) Visit www.reason.tv. reasontv reasontv carey domain drew eminent libertarian magazine property reason reason.com reason.org reason.tv rights nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Brian Doherty on Ayn Rand's Legacy Wed, 07 Nov 2007 15:25:14 -0800

Author: reasontv
Added: Wed, 07 Nov 2007 15:25:14 -0800
Duration: 20

Reason Senior Editor and Radicals for Capitalism author Brian Doherty takes the modernist measure of novelist, philosopher, and cult figure Ayn Rand.

]]> aynbriancapitalismdohertylibertarianmagazineradicalsrandreasonreason.tv http://revver.com/video/472799/brian-doherty-on-ayn-rands-legacy/ http://revver.com/watch/472799 Brian Doherty on Ayn Rand's Legacy Reason Senior Editor and Radicals for Capitalism author Brian Doherty takes the modernist measure of novelist, philosopher, and cult figure Ayn Rand. Reason Senior Editor and Radicals for Capitalism author Brian Doherty takes the modernist measure of novelist, philosopher, and cult figure Ayn Rand. reasontv reasontv ayn brian capitalism doherty libertarian magazine radicals rand reason reason.tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ The Drew Carey Project: Gridlock, Hell on Wheels (Episode 1) Tue, 30 Oct 2007 14:04:05 -0800

Author: reasontv
Added: Tue, 30 Oct 2007 14:04:05 -0800
Duration: 539

Reason.tv Host Drew Carey examines the costs and consequences of traffic jams and explores several solutions that can get our roads moving. How does a speedy trip on the \"Drew Carey Freeway\" sound? One commuter gets a helicopter ride to work.

]]> careycongestiondrewreasontraffictransportation http://revver.com/video/460261/the-drew-carey-project-gridlock-hell-on-wheels-episode-1/ http://revver.com/watch/460261 The Drew Carey Project: Gridlock, Hell on Wheels (Episode 1) Reason.tv Host Drew Carey examines the costs and consequences of traffic jams and explores several solutions that can get our roads moving. How does a speedy trip on the \"Drew Carey Freeway\" sound? One commuter gets a helicopter ride to work. Reason.tv Host Drew Carey examines the costs and consequences of traffic jams and explores several solutions that can get our roads moving. How does a speedy trip on the \"Drew Carey Freeway\" sound? One commuter gets a helicopter ride to work. reasontv reasontv carey congestion drew reason traffic transportation nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/