Videos by revverhbt Videos by revverhbt http://revver.com/u/revverhbt/ http://revver.com webmaster@revver.com The Miracle on 34th Street (1955) - Full Movie Wed, 17 Dec 2008 16:33:23 -0800

Author: revverhbt
Added: Wed, 17 Dec 2008 16:33:23 -0800
Duration: 2762

FULL MOVIE - No Commercials! - The Miracle on 34th Street: The charming story of a Macy's department store Santa who believes he is the real Santa Claus - and his efforts to convince a disbelieving world that he is. Based on the 1947 story by Valentine Davies. Director: Robert Stevenson Writers: Valentine Davies (story) John Monks Jr. (teleplay) Release Date: December 14, 1955 (USA) Teresa Wright ... Doris Walker Thomas Mitchell ... Kris Kringle Don Beddoe ... Mr. Macy Sara Berner ... Woman Shopper Whit Bissell ... Dr. Pierce Macdonald Carey ... Fred Gaily Ray Collins ... Judge Harper Hans Conried ... Mr. Shellhammer Sandy Descher ... Susan Walker Dick Foran ... Thomas Mara Herbert Heyes ... Mr. Gimbel The Miracle on 34th Street (1955) Macy's Department Store Macy's Parade Watch online - Miracle on 34th Street

]]> 34th streetblack and whitechristmasclassiccoolelfholidayskidskriss kringlemacy'smiraclemoviesnew yearnew yearsnew yorkoldparadesantasanta claussanta clausetelevisiontvvintagewinter http://revver.com/video/1385087/the-miracle-on-34th-street-1955-full-movie/ http://revver.com/watch/1385087 The Miracle on 34th Street (1955) - Full Movie FULL MOVIE - No Commercials! - The Miracle on 34th Street: The charming story of a Macy's department store Santa who believes he is the real Santa Claus - and his efforts to convince a disbelieving world that he is. Based on the 1947 story by Valentine Davies. Director: Robert Stevenson Writers: Valentine Davies (story) John Monks Jr. (teleplay) Release Date: December 14, 1955 (USA) Teresa Wright ... Doris Walker Thomas Mitchell ... Kris Kringle Don Beddoe ... Mr. Macy Sara Berner ... Woman Shopper Whit Bissell ... Dr. Pierce Macdonald Carey ... Fred Gaily Ray Collins ... Judge Harper Hans Conried ... Mr. Shellhammer Sandy Descher ... Susan Walker Dick Foran ... Thomas Mara Herbert Heyes ... Mr. Gimbel The Miracle on 34th Street (1955) Macy's Department Store Macy's Parade Watch online - Miracle on 34th Street FULL MOVIE - No Commercials! - The Miracle on 34th Street: The charming story of a Macy's department store Santa who believes he is the real Santa Claus - and his efforts to convince a disbelieving world that he is. Based on the 1947 story by Valentine Davies. Director: Robert Stevenson Writers: Valentine Davies (story) John Monks Jr. (teleplay) Release Date: December 14, 1955 (USA) Teresa Wright ... Doris Walker Thomas Mitchell ... Kris Kringle Don Beddoe ... Mr. Macy Sara Berner ... Woman Shopper Whit Bissell ... Dr. Pierce Macdonald Carey ... Fred Gaily Ray Collins ... Judge Harper Hans Conried ... Mr. Shellhammer Sandy Descher ... Susan Walker Dick Foran ... Thomas Mara Herbert Heyes ... Mr. Gimbel The Miracle on 34th Street (1955) Macy's Department Store Macy's Parade Watch online - Miracle on 34th Street revverhbt revverhbt 34th street black and white christmas classic cool elf holidays kids kriss kringle macy's miracle movies new year new years new york old parade santa santa claus santa clause television tv vintage winter nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Rare Popeye Cartoon - Out To Punch (1956) Sun, 29 Jun 2008 20:24:34 -0800

Author: revverhbt
Added: Sun, 29 Jun 2008 20:24:34 -0800
Duration: 369

A rare Popeye cartoon from 1956. Popeye is training for his boxing match with Bluto. But Bluto, always up for a little sabotage, decides he needs to stop Popeye.

]]> animationblutoboxingcartoonsjump ropeoldolive oylparamount picturespopeyepunching bagsabotagespinachtelevisiontvvintage http://revver.com/video/1000817/rare-popeye-cartoon-out-to-punch-1956/ http://revver.com/watch/1000817 Rare Popeye Cartoon - Out To Punch (1956) A rare Popeye cartoon from 1956. Popeye is training for his boxing match with Bluto. But Bluto, always up for a little sabotage, decides he needs to stop Popeye. A rare Popeye cartoon from 1956. Popeye is training for his boxing match with Bluto. But Bluto, always up for a little sabotage, decides he needs to stop Popeye. revverhbt revverhbt animation bluto boxing cartoons jump rope old olive oyl paramount pictures popeye punching bag sabotage spinach television tv vintage nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ The "You Are An Idiot" Comeback Tue, 15 Apr 2008 22:58:36 -0800

Author: revverhbt
Added: Tue, 15 Apr 2008 22:58:36 -0800
Duration: 21

A childish comeback for all those who annoy you. :P

]]> animationchoruscomebackemoticonsfunnygifhappyidiotjokesmilesmiley facesmileys http://revver.com/video/819958/the-you-are-an-idiot-comeback/ http://revver.com/watch/819958 The "You Are An Idiot" Comeback A childish comeback for all those who annoy you. :P A childish comeback for all those who annoy you. :P revverhbt revverhbt animation chorus comeback emoticons funny gif happy idiot joke smile smiley face smileys nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Hemp for Victory (1942) Sat, 05 Apr 2008 22:49:34 -0800

Author: revverhbt
Added: Sat, 05 Apr 2008 22:49:34 -0800
Duration: 823

A U.S. government propaganda film made during World War II touting the virtues of hemp. The film was aimed at farmers at a time when the military was facing a shortage of hemp. This short film shows how hemp is grown and processed into rope and other products.

]]> abaca plantagaveamericablue grasscanvascordagecorndocumentaryfarmerhempindiajapanesejutekentuckykentucky river gorgemarijuanamissourinavyorganicphilippinespotpropagandareaperropesisaltaxtractorus governmentworld war iiwwii http://revver.com/video/793288/hemp-for-victory-1942/ http://revver.com/watch/793288 Hemp for Victory (1942) A U.S. government propaganda film made during World War II touting the virtues of hemp. The film was aimed at farmers at a time when the military was facing a shortage of hemp. This short film shows how hemp is grown and processed into rope and other products. A U.S. government propaganda film made during World War II touting the virtues of hemp. The film was aimed at farmers at a time when the military was facing a shortage of hemp. This short film shows how hemp is grown and processed into rope and other products. revverhbt revverhbt abaca plant agave america blue grass canvas cordage corn documentary farmer hemp india japanese jute kentucky kentucky river gorge marijuana missouri navy organic philippines pot propaganda reaper rope sisal tax tractor us government world war ii wwii nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Dragnet - The Big Betty (1953) Sat, 05 Apr 2008 18:19:29 -0800

Author: revverhbt
Added: Sat, 05 Apr 2008 18:19:29 -0800
Duration: 1588

Plot: A gang of con artists check the obituary section of the daily newspaper, then use the information they gather to prey on the grief-stricken families of those who have recently died. Starring: Jack Webb, Ben Alexander, Allene Roberts, Gloria Saunders, Robert Clarke, Jack Carol, Mel Ford, Charlotte Lawrence Original air date: September, 24 1953 (Season 3, Episode 4) CC-License: Public Domain

]]> allene robertsben alexanderblack and whitecharlotte lawrenceclassiccon artistscrimedragnetgloria saundersinvestigationjack caroljack webbjoe fridaymel fordoldpolicerobert clarkesergeantshowswindletelevisionthe big bettytv http://revver.com/video/792863/dragnet-the-big-betty-1953/ http://revver.com/watch/792863 Dragnet - The Big Betty (1953) Plot: A gang of con artists check the obituary section of the daily newspaper, then use the information they gather to prey on the grief-stricken families of those who have recently died. Starring: Jack Webb, Ben Alexander, Allene Roberts, Gloria Saunders, Robert Clarke, Jack Carol, Mel Ford, Charlotte Lawrence Original air date: September, 24 1953 (Season 3, Episode 4) CC-License: Public Domain Plot: A gang of con artists check the obituary section of the daily newspaper, then use the information they gather to prey on the grief-stricken families of those who have recently died. Starring: Jack Webb, Ben Alexander, Allene Roberts, Gloria Saunders, Robert Clarke, Jack Carol, Mel Ford, Charlotte Lawrence Original air date: September, 24 1953 (Season 3, Episode 4) CC-License: Public Domain revverhbt revverhbt allene roberts ben alexander black and white charlotte lawrence classic con artists crime dragnet gloria saunders investigation jack carol jack webb joe friday mel ford old police robert clarke sergeant show swindle television the big betty tv nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Rare Superman Cartoon - "Showdown" (1942) Wed, 13 Feb 2008 00:46:20 -0800

Author: revverhbt
Added: Wed, 13 Feb 2008 00:46:20 -0800
Duration: 480

Someone disguised as Superman is committing robberies all over Metropolis. He's doing it under orders from The Boss. Immediately the police start searching for Superman. One night Lois Lane and Clark Kent are covering the opera. The fake Superman decides to rob the patrons there that night. Lois scares him off - but Clark decides to meet him face-to-face and get to the bottom of what's going on. Cast: (in alphabetical order) Joan Alexander ....Lois Lane (voice) (uncredited) Jackson Beck ....The Boss (uncredited) Bud Collyer ....Clark Kent/Superman (voice) (uncredited) Jack Mercer ....Office boy (voice) (uncredited) Director: Izzy Sparber Production Company: Famous Studios Audio/Visual: sound, color

]]> 1942animationcapecartoonsclark jerome kentclark joseph kentclark kentcomiccomic bookfamous studiosjewelslois lanemetropolissuper heroessuperherosupermanthe boss http://revver.com/video/678119/rare-superman-cartoon-showdown-1942/ http://revver.com/watch/678119 Rare Superman Cartoon - "Showdown" (1942) Someone disguised as Superman is committing robberies all over Metropolis. He's doing it under orders from The Boss. Immediately the police start searching for Superman. One night Lois Lane and Clark Kent are covering the opera. The fake Superman decides to rob the patrons there that night. Lois scares him off - but Clark decides to meet him face-to-face and get to the bottom of what's going on. Cast: (in alphabetical order) Joan Alexander ....Lois Lane (voice) (uncredited) Jackson Beck ....The Boss (uncredited) Bud Collyer ....Clark Kent/Superman (voice) (uncredited) Jack Mercer ....Office boy (voice) (uncredited) Director: Izzy Sparber Production Company: Famous Studios Audio/Visual: sound, color Someone disguised as Superman is committing robberies all over Metropolis. He's doing it under orders from The Boss. Immediately the police start searching for Superman. One night Lois Lane and Clark Kent are covering the opera. The fake Superman decides to rob the patrons there that night. Lois scares him off - but Clark decides to meet him face-to-face and get to the bottom of what's going on. Cast: (in alphabetical order) Joan Alexander ....Lois Lane (voice) (uncredited) Jackson Beck ....The Boss (uncredited) Bud Collyer ....Clark Kent/Superman (voice) (uncredited) Jack Mercer ....Office boy (voice) (uncredited) Director: Izzy Sparber Production Company: Famous Studios Audio/Visual: sound, color revverhbt revverhbt 1942 animation cape cartoons clark jerome kent clark joseph kent clark kent comic comic book famous studios jewels lois lane metropolis super heroes superhero superman the boss nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ 40 Years of Reconnaissance Tue, 12 Feb 2008 23:46:20 -0800

Author: revverhbt
Added: Tue, 12 Feb 2008 23:46:20 -0800
Duration: 338

A recently declassified video by the NRO (National Reconnaissance Office). The NRO is the once super-secret spy agency responsible for the United State's satellite and aerial reconnaissance missions. This declassified video is a montage of satellite launches, dial-twiddling technicians, and military hardware, showing historical footage from the past 40 years. Located in Chantilly, Virginia, The NRO is one of the 16 intelligence agencies in the U.S. and still designs, builds and operates the reconnaissance satellites of the United States government.

]]> aif forcearmybill clintondesert stormeisenhowerexplosionfidel castrogorbachevgovernmentgunshistoryhostagesjfkjohn f. kennedykennedynasanational reconnaissance officenroosama bin ladenpeacepoliticsrocketsronald reagansaddam husseinsatellitestop secretunited statesvietnamwar http://revver.com/video/677940/40-years-of-reconnaissance/ http://revver.com/watch/677940 40 Years of Reconnaissance A recently declassified video by the NRO (National Reconnaissance Office). The NRO is the once super-secret spy agency responsible for the United State's satellite and aerial reconnaissance missions. This declassified video is a montage of satellite launches, dial-twiddling technicians, and military hardware, showing historical footage from the past 40 years. Located in Chantilly, Virginia, The NRO is one of the 16 intelligence agencies in the U.S. and still designs, builds and operates the reconnaissance satellites of the United States government. A recently declassified video by the NRO (National Reconnaissance Office). The NRO is the once super-secret spy agency responsible for the United State's satellite and aerial reconnaissance missions. This declassified video is a montage of satellite launches, dial-twiddling technicians, and military hardware, showing historical footage from the past 40 years. Located in Chantilly, Virginia, The NRO is one of the 16 intelligence agencies in the U.S. and still designs, builds and operates the reconnaissance satellites of the United States government. revverhbt revverhbt aif force army bill clinton desert storm eisenhower explosion fidel castro gorbachev government guns history hostages jfk john f. kennedy kennedy nasa national reconnaissance office nro osama bin laden peace politics rockets ronald reagan saddam hussein satellites top secret united states vietnam war nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bunker Buster Bomb Demo With Explosion Sun, 13 Jan 2008 22:06:32 -0800

Author: revverhbt
Added: Sun, 13 Jan 2008 22:06:32 -0800
Duration: 33

Here's a bunker buster bomb demo. Watch as it rips right through the concrete like a hot knife through butter. In the video, the U.S. Air Force Small Diameter Bomb (SDB) takes out a bunker. The 250 pound SDB is designed to penetrate concrete or earth. The wings on the SDB in the video are actually an add-on (to be used on many smart bombs), called Diamond Back. When the Diamond Back kit is added, the smart bomb's range increases from about 16 kilometers to 65 kilometers. The Small Diameter Bomb system is currently in full production. Great, just what we need...more ways to kill people. Booooo!

]]> air forceairplaneblow upboeingbombbombsbunkerbunker busterconcretediamond backexplosionexplosionsexplosiveexplosivesfiregovernmentjetmilitarysdbshrapnelsmokeu.s. air forceunited stateswar http://revver.com/video/615260/bunker-buster-bomb-demo-with-explosion/ http://revver.com/watch/615260 Bunker Buster Bomb Demo With Explosion Here's a bunker buster bomb demo. Watch as it rips right through the concrete like a hot knife through butter. In the video, the U.S. Air Force Small Diameter Bomb (SDB) takes out a bunker. The 250 pound SDB is designed to penetrate concrete or earth. The wings on the SDB in the video are actually an add-on (to be used on many smart bombs), called Diamond Back. When the Diamond Back kit is added, the smart bomb's range increases from about 16 kilometers to 65 kilometers. The Small Diameter Bomb system is currently in full production. Great, just what we need...more ways to kill people. Booooo! Here's a bunker buster bomb demo. Watch as it rips right through the concrete like a hot knife through butter. In the video, the U.S. Air Force Small Diameter Bomb (SDB) takes out a bunker. The 250 pound SDB is designed to penetrate concrete or earth. The wings on the SDB in the video are actually an add-on (to be used on many smart bombs), called Diamond Back. When the Diamond Back kit is added, the smart bomb's range increases from about 16 kilometers to 65 kilometers. The Small Diameter Bomb system is currently in full production. Great, just what we need...more ways to kill people. Booooo! revverhbt revverhbt air force airplane blow up boeing bomb bombs bunker bunker buster concrete diamond back explosion explosions explosive explosives fire government jet military sdb shrapnel smoke u.s. air force united states war nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Apache Helicopter Shoots Insurgents (Unedited version) Fri, 16 Nov 2007 23:25:08 -0800

Author: revverhbt
Added: Fri, 16 Nov 2007 23:25:08 -0800
Duration: 224

The terrible world in which we live... A US Apache helicopter shoots down men "thought" to be carrying weapons. The action took place on December 1, 2003. The soldiers heard in the video are from the Army's 4th Infantry Division and the weapons fired were the helicopter's 30mm cannons. Over 100 rounds were fired in total.

]]> 2003air forceapache helicopterarmyattackhelicopteriraqiraq wariraqimarinesmilitarymissilesnavyrpgshootunited statesuswarwar footage http://revver.com/video/487820/apache-helicopter-shoots-insurgents-unedited-version/ http://revver.com/watch/487820 Apache Helicopter Shoots Insurgents (Unedited version) The terrible world in which we live... A US Apache helicopter shoots down men "thought" to be carrying weapons. The action took place on December 1, 2003. The soldiers heard in the video are from the Army's 4th Infantry Division and the weapons fired were the helicopter's 30mm cannons. Over 100 rounds were fired in total. The terrible world in which we live... A US Apache helicopter shoots down men "thought" to be carrying weapons. The action took place on December 1, 2003. The soldiers heard in the video are from the Army's 4th Infantry Division and the weapons fired were the helicopter's 30mm cannons. Over 100 rounds were fired in total. revverhbt revverhbt 2003 air force apache helicopter army attack helicopter iraq iraq war iraqi marines military missiles navy rpg shoot united states us war war footage nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Jim Morrison 1964 FSU College Promo Video Sun, 11 Nov 2007 22:55:10 -0800

Author: revverhbt
Added: Sun, 11 Nov 2007 22:55:10 -0800
Duration: 89

This video clip of Jim Morrison was discovered among films that WFSU (a PBS station operated by Florida State University) had donated to the state of Florida in 1989. After it was found it was digitally converted and posted to the state's film arching website. The video was found accidentally by Jaime Madden. When he watched the video he said, "Oh my god! This is Jim Morrison!''' Finds like these definitely highlight an archivists' duty to pay attention to detail!

]]> 60'sarchivesblack and whitecollegefilmfloridaflorida state universityfsujim morrisonmiamimusicpromosrock and rollthe doorsuclavideos http://revver.com/video/479068/jim-morrison-1964-fsu-college-promo-video/ http://revver.com/watch/479068 Jim Morrison 1964 FSU College Promo Video This video clip of Jim Morrison was discovered among films that WFSU (a PBS station operated by Florida State University) had donated to the state of Florida in 1989. After it was found it was digitally converted and posted to the state's film arching website. The video was found accidentally by Jaime Madden. When he watched the video he said, "Oh my god! This is Jim Morrison!''' Finds like these definitely highlight an archivists' duty to pay attention to detail! This video clip of Jim Morrison was discovered among films that WFSU (a PBS station operated by Florida State University) had donated to the state of Florida in 1989. After it was found it was digitally converted and posted to the state's film arching website. The video was found accidentally by Jaime Madden. When he watched the video he said, "Oh my god! This is Jim Morrison!''' Finds like these definitely highlight an archivists' duty to pay attention to detail! revverhbt revverhbt 60's archives black and white college film florida florida state university fsu jim morrison miami music promos rock and roll the doors ucla videos nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Popeye The Sailor - Blow Me Down! Sat, 10 Nov 2007 00:13:06 -0800

Author: revverhbt
Added: Sat, 10 Nov 2007 00:13:06 -0800
Duration: 387

In this early and rarely seen Popeye animation, Popeye sails into Mexico...on a whale! Olive is in a cantina doing a very wacky Mexican hat dance, and Popeye enjoys the show. That is, until Bluto comes in and clears the bar. Popeye eventually eats his spinach and he and Bluto compete.

]]> animationbarblack and whiteblutocantinacartooncartoonscomedyfilmfunnyoldolive oylparamountpicturespopeyepopeye the sailorshortvintage cartoons http://revver.com/video/476619/popeye-the-sailor-blow-me-down/ http://revver.com/watch/476619 Popeye The Sailor - Blow Me Down! In this early and rarely seen Popeye animation, Popeye sails into Mexico...on a whale! Olive is in a cantina doing a very wacky Mexican hat dance, and Popeye enjoys the show. That is, until Bluto comes in and clears the bar. Popeye eventually eats his spinach and he and Bluto compete. In this early and rarely seen Popeye animation, Popeye sails into Mexico...on a whale! Olive is in a cantina doing a very wacky Mexican hat dance, and Popeye enjoys the show. That is, until Bluto comes in and clears the bar. Popeye eventually eats his spinach and he and Bluto compete. revverhbt revverhbt animation bar black and white bluto cantina cartoon cartoons comedy film funny old olive oyl paramount pictures popeye popeye the sailor short vintage cartoons nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ One Of The Very First Beer Commercials Thu, 27 Sep 2007 21:54:17 -0800

Author: revverhbt
Added: Thu, 27 Sep 2007 21:54:17 -0800
Duration: 20

This Labatt's commercial is one of the first beer commercials on television. And while it's pretty tame by today's standards, one has to admit that it's pure, classic Canadiana. So have an adventure - have a Labatt's.

]]> advertisingalcoholbeerbeveragecanadacanadiancommercialdrinkdrinkingfunnylabattoldtvvintage http://revver.com/video/413105/one-of-the-very-first-beer-commercials/ http://revver.com/watch/413105 One Of The Very First Beer Commercials This Labatt's commercial is one of the first beer commercials on television. And while it's pretty tame by today's standards, one has to admit that it's pure, classic Canadiana. So have an adventure - have a Labatt's. This Labatt's commercial is one of the first beer commercials on television. And while it's pretty tame by today's standards, one has to admit that it's pure, classic Canadiana. So have an adventure - have a Labatt's. revverhbt revverhbt advertising alcohol beer beverage canada canadian commercial drink drinking funny labatt old tv vintage nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Amazing Illusions - Pavement Art Wed, 26 Sep 2007 07:51:13 -0800

Author: revverhbt
Added: Wed, 26 Sep 2007 07:51:13 -0800
Duration: 179

Julian Beever is an English chalk artist who's been creating trompe-l'œil chalk drawings on pavement surfaces since the mid-1990s. He's worked in the UK, Belgium, France, The Netherlands, Germany, Austria, Denmark, Spain, the USA and Australia. His works are created using a projection called anamorphosis, and create the illusion of three dimensions when viewed from the right angle. Note: Some artworks depicted are by Kurt Wenner. They are: Cerres Banquet (6th & 27th image shown), Lincoln (31st image shown), Amp'd Mobile (12th image shown), Calgary Stampede (32rd image shown)

]]> 3danamorphosisartartistsbeeverchalkcooldrawingsillusionsjuliankurt wennermuralspaintingpicassosidewalksidewalk artsidewalk paintingstrompe-lœil http://revver.com/video/410594/amazing-illusions-pavement-art/ http://revver.com/watch/410594 Amazing Illusions - Pavement Art Julian Beever is an English chalk artist who's been creating trompe-l'œil chalk drawings on pavement surfaces since the mid-1990s. He's worked in the UK, Belgium, France, The Netherlands, Germany, Austria, Denmark, Spain, the USA and Australia. His works are created using a projection called anamorphosis, and create the illusion of three dimensions when viewed from the right angle. Note: Some artworks depicted are by Kurt Wenner. They are: Cerres Banquet (6th & 27th image shown), Lincoln (31st image shown), Amp'd Mobile (12th image shown), Calgary Stampede (32rd image shown) Julian Beever is an English chalk artist who's been creating trompe-l'œil chalk drawings on pavement surfaces since the mid-1990s. He's worked in the UK, Belgium, France, The Netherlands, Germany, Austria, Denmark, Spain, the USA and Australia. His works are created using a projection called anamorphosis, and create the illusion of three dimensions when viewed from the right angle. Note: Some artworks depicted are by Kurt Wenner. They are: Cerres Banquet (6th & 27th image shown), Lincoln (31st image shown), Amp'd Mobile (12th image shown), Calgary Stampede (32rd image shown) revverhbt revverhbt 3d anamorphosis art artists beever chalk cool drawings illusions julian kurt wenner murals painting picasso sidewalk sidewalk art sidewalk paintings trompe-lœil nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Popeye The Sailor - Blow Me Down! Wed, 12 Sep 2007 16:25:07 -0800

Author: revverhbt
Added: Wed, 12 Sep 2007 16:25:07 -0800
Duration: 378

In this early and rarely seen Popeye animation, Popeye sails into Mexico...on a whale! Olive is in a cantina doing a very wacky Mexican hat dance, and Popeye enjoys the show. That is, until Bluto comes in and clears the bar. Popeye eventually has his spinach and he and Bluto compete.

]]> animationbarblack and whiteblutocantinacartooncartoonscomedyfilmfunnyoldparamountpicturespopeyepopeye the sailorvintage cartoons http://revver.com/video/394749/popeye-the-sailor-blow-me-down/ http://revver.com/watch/394749 Popeye The Sailor - Blow Me Down! In this early and rarely seen Popeye animation, Popeye sails into Mexico...on a whale! Olive is in a cantina doing a very wacky Mexican hat dance, and Popeye enjoys the show. That is, until Bluto comes in and clears the bar. Popeye eventually has his spinach and he and Bluto compete. In this early and rarely seen Popeye animation, Popeye sails into Mexico...on a whale! Olive is in a cantina doing a very wacky Mexican hat dance, and Popeye enjoys the show. That is, until Bluto comes in and clears the bar. Popeye eventually has his spinach and he and Bluto compete. revverhbt revverhbt animation bar black and white bluto cantina cartoon cartoons comedy film funny old paramount pictures popeye popeye the sailor vintage cartoons nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bunny And Benny - Bumping To The Music Sun, 02 Sep 2007 22:35:10 -0800

Author: revverhbt
Added: Sun, 02 Sep 2007 22:35:10 -0800
Duration: 15

Bunny and Benny and the Bremen MP74.

]]> blaupunktbremenbunnycarcarscommercialsfunnymusicradiosoundstereossystemsteddy beartunerviral commercials http://revver.com/video/299580/bunny-and-benny-bumping-to-the-music/ http://revver.com/watch/299580 Bunny And Benny - Bumping To The Music Bunny and Benny and the Bremen MP74. Bunny and Benny and the Bremen MP74. revverhbt revverhbt blaupunkt bremen bunny car cars commercials funny music radio sound stereos systems teddy bear tuner viral commercials nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/