Videos by screencastcent Videos by screencastcent http://revver.com/u/screencastcent/ http://revver.com webmaster@revver.com Photoshop Tutorial Levitate an Apple Fri, 02 May 2008 15:58:39 -0800

Author: screencastcent
Added: Fri, 02 May 2008 15:58:39 -0800
Duration: 41

Using photoshop you can create a great looking apple levitation effect in less than 5 minutes. I show you how at videophd.com

]]> (adobe)(class)(course)(for)(learn)(online)(photo)(photoshop)(shop)(total)(training)(tutorial)(tutorials)(video) http://revver.com/video/859171/photoshop-tutorial-levitate-an-apple/ http://revver.com/watch/859171 Photoshop Tutorial Levitate an Apple Using photoshop you can create a great looking apple levitation effect in less than 5 minutes. I show you how at videophd.com Using photoshop you can create a great looking apple levitation effect in less than 5 minutes. I show you how at videophd.com screencastcent screencastcent (adobe) (class) (course) (for) (learn) (online) (photo) (photoshop) (shop) (total) (training) (tutorial) (tutorials) (video) nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Adding songs to and from your Samsung YP-Z5 MP3 Player Fri, 18 Apr 2008 10:49:35 -0800

Author: screencastcent
Added: Fri, 18 Apr 2008 10:49:35 -0800
Duration: 221

visit http://www.screencastcentral.com/members/801.cfm for the full quality video. Adding and removing songs to and from your Samsung YP-Z5 MP3 Player

]]> addbrowsecableconnectfilefolderhowimportmp3musicplayersamsungsongsongstousbypyp-z5ypz5z5 http://revver.com/video/826091/adding-songs-to-and-from-your-samsung-yp-z5-mp3-player/ http://revver.com/watch/826091 Adding songs to and from your Samsung YP-Z5 MP3 Player visit http://www.screencastcentral.com/members/801.cfm for the full quality video. Adding and removing songs to and from your Samsung YP-Z5 MP3 Player visit http://www.screencastcentral.com/members/801.cfm for the full quality video. Adding and removing songs to and from your Samsung YP-Z5 MP3 Player screencastcent screencastcent add browse cable connect file folder how import mp3 music player samsung song songs to usb yp yp-z5 ypz5 z5 nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Introduction to Photoshop CS3 Interface Thu, 17 Apr 2008 19:19:31 -0800

Author: screencastcent
Added: Thu, 17 Apr 2008 19:19:31 -0800
Duration: 496

A quick introduction to Photoshop CS3 an its interface: tool box, menu, panels, etc.

]]> cs3interfacephotoshoptoolbox http://revver.com/video/824780/introduction-to-photoshop-cs3-interface/ http://revver.com/watch/824780 Introduction to Photoshop CS3 Interface A quick introduction to Photoshop CS3 an its interface: tool box, menu, panels, etc. A quick introduction to Photoshop CS3 an its interface: tool box, menu, panels, etc. screencastcent screencastcent cs3 interface photoshop toolbox nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Photoshop CS3 Painting Strokes on an Image Thu, 17 Apr 2008 09:55:33 -0800

Author: screencastcent
Added: Thu, 17 Apr 2008 09:55:33 -0800
Duration: 525

You can use the paintbrush to get some great effects in photoshop.

]]> brushescs3paintphotoshopstrokes http://revver.com/video/823537/photoshop-cs3-painting-strokes-on-an-image/ http://revver.com/watch/823537 Photoshop CS3 Painting Strokes on an Image You can use the paintbrush to get some great effects in photoshop. You can use the paintbrush to get some great effects in photoshop. screencastcent screencastcent brushes cs3 paint photoshop strokes nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Tubemogul - Mark Rotblat. Uploading and Launching your videi Fri, 28 Mar 2008 07:46:17 -0800

Author: screencastcent
Added: Fri, 28 Mar 2008 07:46:17 -0800
Duration: 260

please visit http://www.screencastcentral/ for higher quality screencasts and more from Tubeomgul's Mark Rotblat! Here, Mark shows up how to upload and launch a video onto the site and how to distribute them to the various free video hosting sites.

]]> adddescriptionhowhowtolaunchmarkmogulrotblatscreencasttagstitletotooltubetubemogultutorialuploadvideo http://revver.com/video/773777/tubemogul-mark-rotblat-uploading-and-launching-your-videi/ http://revver.com/watch/773777 Tubemogul - Mark Rotblat. Uploading and Launching your videi please visit http://www.screencastcentral/ for higher quality screencasts and more from Tubeomgul's Mark Rotblat! Here, Mark shows up how to upload and launch a video onto the site and how to distribute them to the various free video hosting sites. please visit http://www.screencastcentral/ for higher quality screencasts and more from Tubeomgul's Mark Rotblat! Here, Mark shows up how to upload and launch a video onto the site and how to distribute them to the various free video hosting sites. screencastcent screencastcent add description how howto launch mark mogul rotblat screencast tags title to tool tube tubemogul tutorial upload video nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ How to convert Microsoft clipart to EPS Thu, 27 Mar 2008 10:49:37 -0800

Author: screencastcent
Added: Thu, 27 Mar 2008 10:49:37 -0800
Duration: 129

Original version http://www.screencastcentral.com/public/818.cfm In this video tutorial we look at how to quickly and easily convert a file using the great free service at www.Media-Convert.com However, on checking, only www.Media-Convert.com ...

]]> clipartconversionconvertfilefilesfreemediamedia-convert.commicrosoftonlinescreencastcentralzamzar http://revver.com/video/772000/how-to-convert-microsoft-clipart-to-eps/ http://revver.com/watch/772000 How to convert Microsoft clipart to EPS Original version http://www.screencastcentral.com/public/818.cfm In this video tutorial we look at how to quickly and easily convert a file using the great free service at www.Media-Convert.com However, on checking, only www.Media-Convert.com ... Original version http://www.screencastcentral.com/public/818.cfm In this video tutorial we look at how to quickly and easily convert a file using the great free service at www.Media-Convert.com However, on checking, only www.Media-Convert.com ... screencastcent screencastcent clipart conversion convert file files free media media-convert.com microsoft online screencastcentral zamzar nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Tubemogul Emailing & scheduling reports to yourself, Mark Rotblat Thu, 27 Mar 2008 10:49:37 -0800

Author: screencastcent
Added: Thu, 27 Mar 2008 10:49:37 -0800
Duration: 195

http://www.screencastcentral.com/members/department44.cfm Here, Mark Rotblat shows how simple and easy it is for you to e-mail your tracking reports to yourself and other people. He also show you how you can use the embed code for your reports onto ...

]]> codee-mailemailembedexporthowmailmarkmogulpublishrotblatsendtubetubemogul http://revver.com/video/772078/tubemogul-emailing-scheduling-reports-to-yourself-mark-rotblat/ http://revver.com/watch/772078 Tubemogul Emailing & scheduling reports to yourself, Mark Rotblat http://www.screencastcentral.com/members/department44.cfm Here, Mark Rotblat shows how simple and easy it is for you to e-mail your tracking reports to yourself and other people. He also show you how you can use the embed code for your reports onto ... http://www.screencastcentral.com/members/department44.cfm Here, Mark Rotblat shows how simple and easy it is for you to e-mail your tracking reports to yourself and other people. He also show you how you can use the embed code for your reports onto ... screencastcent screencastcent code e-mail email embed export how mail mark mogul publish rotblat send tube tubemogul nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ How to Create previously edited photos with Picnik.com free Sat, 22 Dec 2007 07:04:09 -0800

Author: screencastcent
Added: Sat, 22 Dec 2007 07:04:09 -0800
Duration: 250

With this screencast you'll learn how to create (add borders,touch-up and many more) professional looking features with Picnik.com the free and easy image editing website.

]]> centraleasyediteditingfreefriendsholidayimagepicturesscreencastwebsite http://revver.com/video/580854/how-to-create-previously-edited-photos-with-picnikcom-free/ http://revver.com/watch/580854 How to Create previously edited photos with Picnik.com free With this screencast you'll learn how to create (add borders,touch-up and many more) professional looking features with Picnik.com the free and easy image editing website. With this screencast you'll learn how to create (add borders,touch-up and many more) professional looking features with Picnik.com the free and easy image editing website. screencastcent screencastcent central easy edit editing free friends holiday image pictures screencast website nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ How to Download, Install and Use Google Talk on your PC. Tue, 18 Dec 2007 07:49:06 -0800

Author: screencastcent
Added: Tue, 18 Dec 2007 07:49:06 -0800
Duration: 125

visit www.screencastcentral.com for more. Google Talk is an application that allows you to shat to your Googlemail(Gmail) contacts without being signed into your online Googlemail inbox.

]]> chatdownloadgoogleinstallpctalkuse http://revver.com/video/552198/how-to-download-install-and-use-google-talk-on-your-pc/ http://revver.com/watch/552198 How to Download, Install and Use Google Talk on your PC. visit www.screencastcentral.com for more. Google Talk is an application that allows you to shat to your Googlemail(Gmail) contacts without being signed into your online Googlemail inbox. visit www.screencastcentral.com for more. Google Talk is an application that allows you to shat to your Googlemail(Gmail) contacts without being signed into your online Googlemail inbox. screencastcent screencastcent chat download google install pc talk use nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ How to change the size of a video using simple HTML. Tue, 18 Dec 2007 07:34:16 -0800

Author: screencastcent
Added: Tue, 18 Dec 2007 07:34:16 -0800
Duration: 127

visit www.screencastcentral.com for more. In the embed code for a video, you can change certain numbers for the width and height of your video. In this screencast, I show you how to do this quickly and simply.

]]> changecodeeditembedheighthtmlsizevideowidth http://revver.com/video/548412/how-to-change-the-size-of-a-video-using-simple-html/ http://revver.com/watch/548412 How to change the size of a video using simple HTML. visit www.screencastcentral.com for more. In the embed code for a video, you can change certain numbers for the width and height of your video. In this screencast, I show you how to do this quickly and simply. visit www.screencastcentral.com for more. In the embed code for a video, you can change certain numbers for the width and height of your video. In this screencast, I show you how to do this quickly and simply. screencastcent screencastcent change code edit embed height html size video width nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ How to change the alignment of headings in Open Office Calc to fit all your data onto one page. Tue, 18 Dec 2007 07:34:16 -0800

Author: screencastcent
Added: Tue, 18 Dec 2007 07:34:16 -0800
Duration: 123

visit www.screencastcentral.com for more. How to change the alignment of headings in Open Office Calc to fit all your data onto one page. Here I show you how to save space on your page by changing the alignment of your headings in Open Office Calc.

]]> alignmentcalcchangefitheadingofficeopenpageprint http://revver.com/video/546176/how-to-change-the-alignment-of-headings-in-open-office-calc-to-fit-all-your-data-onto-one-page/ http://revver.com/watch/546176 How to change the alignment of headings in Open Office Calc to fit all your data onto one page. visit www.screencastcentral.com for more. How to change the alignment of headings in Open Office Calc to fit all your data onto one page. Here I show you how to save space on your page by changing the alignment of your headings in Open Office Calc. visit www.screencastcentral.com for more. How to change the alignment of headings in Open Office Calc to fit all your data onto one page. Here I show you how to save space on your page by changing the alignment of your headings in Open Office Calc. screencastcent screencastcent alignment calc change fit heading office open page print nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ How to create and save an address book in Open Office Calc Tue, 18 Dec 2007 07:34:16 -0800

Author: screencastcent
Added: Tue, 18 Dec 2007 07:34:16 -0800
Duration: 129

visit www.screencastcentral.com for more. In this tutorial, I show you how to enter the addresses of your contacts into a spreadsheet with clear headings. This address book can then be saved and edited whenever anyone changes location.

]]> addressbookcontactscreatemakesavespreadsheet http://revver.com/video/548059/how-to-create-and-save-an-address-book-in-open-office-calc/ http://revver.com/watch/548059 How to create and save an address book in Open Office Calc visit www.screencastcentral.com for more. In this tutorial, I show you how to enter the addresses of your contacts into a spreadsheet with clear headings. This address book can then be saved and edited whenever anyone changes location. visit www.screencastcentral.com for more. In this tutorial, I show you how to enter the addresses of your contacts into a spreadsheet with clear headings. This address book can then be saved and edited whenever anyone changes location. screencastcent screencastcent address book contacts create make save spreadsheet nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Uploading photos to Photobucket and embedding an image onto your Myspace profile Mon, 17 Dec 2007 08:58:07 -0800

Author: screencastcent
Added: Mon, 17 Dec 2007 08:58:07 -0800
Duration: 156

visit www.screencastcentral.com for more. Uploading photos to Photobucket and embedding an image onto your Myspace profile. In this screencast, I show you how to use simple HTML to embed an image onto your Myspace profile using Photobucket.

]]> bucketembedmyspacephotophotobucketprofileupload http://revver.com/video/532279/uploading-photos-to-photobucket-and-embedding-an-image-onto-your-myspace-profile/ http://revver.com/watch/532279 Uploading photos to Photobucket and embedding an image onto your Myspace profile visit www.screencastcentral.com for more. Uploading photos to Photobucket and embedding an image onto your Myspace profile. In this screencast, I show you how to use simple HTML to embed an image onto your Myspace profile using Photobucket. visit www.screencastcentral.com for more. Uploading photos to Photobucket and embedding an image onto your Myspace profile. In this screencast, I show you how to use simple HTML to embed an image onto your Myspace profile using Photobucket. screencastcent screencastcent bucket embed myspace photo photobucket profile upload nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ How to create an in-cell bar graph using Open Office Calc Mon, 17 Dec 2007 06:30:57 -0800

Author: screencastcent
Added: Mon, 17 Dec 2007 06:30:57 -0800
Duration: 118

visit www.screencastcentral.com for more. In this quick tutorial, I show you how to compare data using an in-cell bar graph in the Open Office Calc Program by using the '=REPT' formula.

]]> barcalccellchartcreategraphin-cellmakeofficeopensorttally http://revver.com/video/532168/how-to-create-an-in-cell-bar-graph-using-open-office-calc/ http://revver.com/watch/532168 How to create an in-cell bar graph using Open Office Calc visit www.screencastcentral.com for more. In this quick tutorial, I show you how to compare data using an in-cell bar graph in the Open Office Calc Program by using the '=REPT' formula. visit www.screencastcentral.com for more. In this quick tutorial, I show you how to compare data using an in-cell bar graph in the Open Office Calc Program by using the '=REPT' formula. screencastcent screencastcent bar calc cell chart create graph in-cell make office open sort tally nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ How to upload photos to your Myspace Fri, 14 Dec 2007 06:58:08 -0800

Author: screencastcent
Added: Fri, 14 Dec 2007 06:58:08 -0800
Duration: 80

visit www.screencastcentral.com for more. This tutorial shows you how to add photos to your myspace account and also shows how other people will view your images.

]]> imagesmyspacephotographsphotosupload http://revver.com/video/527694/how-to-upload-photos-to-your-myspace/ http://revver.com/watch/527694 How to upload photos to your Myspace visit www.screencastcentral.com for more. This tutorial shows you how to add photos to your myspace account and also shows how other people will view your images. visit www.screencastcentral.com for more. This tutorial shows you how to add photos to your myspace account and also shows how other people will view your images. screencastcent screencastcent images myspace photographs photos upload nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Adding/Removing songs from your Myspace profile Fri, 14 Dec 2007 06:58:08 -0800

Author: screencastcent
Added: Fri, 14 Dec 2007 06:58:08 -0800
Duration: 116

visit www.screencastcentral.com for more. In this screencast, I show you how to add a song to your Myspace profile and how to use the profile player tools. I also show you 2 different ways to remove a song from your profile.

]]> addmyspaceprofileremovesongsongs http://revver.com/video/527698/addingremoving-songs-from-your-myspace-profile/ http://revver.com/watch/527698 Adding/Removing songs from your Myspace profile visit www.screencastcentral.com for more. In this screencast, I show you how to add a song to your Myspace profile and how to use the profile player tools. I also show you 2 different ways to remove a song from your profile. visit www.screencastcentral.com for more. In this screencast, I show you how to add a song to your Myspace profile and how to use the profile player tools. I also show you 2 different ways to remove a song from your profile. screencastcent screencastcent add myspace profile remove song songs nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ How to send someone a message on Myspace. Thu, 13 Dec 2007 09:40:20 -0800

Author: screencastcent
Added: Thu, 13 Dec 2007 09:40:20 -0800
Duration: 51

visit www.screencastcentral.com for more. In this tutorial, I show you how to send a message to one of your friends on Myspace.

]]> messagemyspacescreencastsendtutorial http://revver.com/video/526362/how-to-send-someone-a-message-on-myspace/ http://revver.com/watch/526362 How to send someone a message on Myspace. visit www.screencastcentral.com for more. In this tutorial, I show you how to send a message to one of your friends on Myspace. visit www.screencastcentral.com for more. In this tutorial, I show you how to send a message to one of your friends on Myspace. screencastcent screencastcent message myspace screencast send tutorial nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Signing up for a myspace account. Thu, 13 Dec 2007 08:58:06 -0800

Author: screencastcent
Added: Thu, 13 Dec 2007 08:58:06 -0800
Duration: 164

visit www.screencastcentral.com for more. In this screencast, I show you how to sign-up with myspace.com.

]]> accountmakemyspacenewscreencastsign-upsignuptutorial http://revver.com/video/526275/signing-up-for-a-myspace-account/ http://revver.com/watch/526275 Signing up for a myspace account. visit www.screencastcentral.com for more. In this screencast, I show you how to sign-up with myspace.com. visit www.screencastcentral.com for more. In this screencast, I show you how to sign-up with myspace.com. screencastcent screencastcent account make myspace new screencast sign-up signup tutorial nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ MyPAYE Login Process Wed, 12 Dec 2007 08:49:05 -0800

Author: screencastcent
Added: Wed, 12 Dec 2007 08:49:05 -0800
Duration: 131

visit www.screencastcentral.com for more. Once you have signed up to MyPaye, you will have to login each time you wish to use the service. Let's take a look at the MyPAYE Login process.

]]> logloginmymypayepayeprocess http://revver.com/video/524547/mypaye-login-process/ http://revver.com/watch/524547 MyPAYE Login Process visit www.screencastcentral.com for more. Once you have signed up to MyPaye, you will have to login each time you wish to use the service. Let's take a look at the MyPAYE Login process. visit www.screencastcentral.com for more. Once you have signed up to MyPaye, you will have to login each time you wish to use the service. Let's take a look at the MyPAYE Login process. screencastcent screencastcent log login my mypaye paye process nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ How to set up a new account with MyPAYEan online payroll management service. Wed, 12 Dec 2007 08:49:05 -0800

Author: screencastcent
Added: Wed, 12 Dec 2007 08:49:05 -0800
Duration: 1145

visit www.screencastcentral.com for more. How to set up a new account with MyPAYE an online payroll management service. Payroll management software is a lifesaver these days, turning hours of work and PAYE calculations into a couple of clicks.

]]> accountmanagementmymypayenewonlinepayepaymentservicesetset-upsetupup http://revver.com/video/524554/how-to-set-up-a-new-account-with-mypayean-online-payroll-management-service/ http://revver.com/watch/524554 How to set up a new account with MyPAYEan online payroll management service. visit www.screencastcentral.com for more. How to set up a new account with MyPAYE an online payroll management service. Payroll management software is a lifesaver these days, turning hours of work and PAYE calculations into a couple of clicks. visit www.screencastcentral.com for more. How to set up a new account with MyPAYE an online payroll management service. Payroll management software is a lifesaver these days, turning hours of work and PAYE calculations into a couple of clicks. screencastcent screencastcent account management my mypaye new online paye payment service set set-up setup up nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ MyPAYE - Running The Payroll Wed, 12 Dec 2007 08:49:05 -0800

Author: screencastcent
Added: Wed, 12 Dec 2007 08:49:05 -0800
Duration: 451

visit www.screencastcentral.com for more. Having set up our payroll options - weekly and monthly - and having added the details of the employees into those payrolls, we can now set MyPAYE to run the payroll.

]]> mymypayepayepayrollrunrunning http://revver.com/video/524559/mypaye-running-the-payroll/ http://revver.com/watch/524559 MyPAYE - Running The Payroll visit www.screencastcentral.com for more. Having set up our payroll options - weekly and monthly - and having added the details of the employees into those payrolls, we can now set MyPAYE to run the payroll. visit www.screencastcentral.com for more. Having set up our payroll options - weekly and monthly - and having added the details of the employees into those payrolls, we can now set MyPAYE to run the payroll. screencastcent screencastcent my mypaye paye payroll run running nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Blogging for Beginners - Downloading, Configuring and Installing Wordpress on your Web Serve Wed, 12 Dec 2007 08:49:05 -0800

Author: screencastcent
Added: Wed, 12 Dec 2007 08:49:05 -0800
Duration: 217

www.screencastcentral.com for more. In this screencast we guide you through the download process, editing the source files to make a connection to your database, uploading the files to the server, then finally through the installation process itself

]]> blogbloggingconfigureconfiguringdownloaddownloadinginstallinstallingserverwordpress http://revver.com/video/524562/blogging-for-beginners-downloading-configuring-and-installing-wordpress-on-your-web-serve/ http://revver.com/watch/524562 Blogging for Beginners - Downloading, Configuring and Installing Wordpress on your Web Serve www.screencastcentral.com for more. In this screencast we guide you through the download process, editing the source files to make a connection to your database, uploading the files to the server, then finally through the installation process itself www.screencastcentral.com for more. In this screencast we guide you through the download process, editing the source files to make a connection to your database, uploading the files to the server, then finally through the installation process itself screencastcent screencastcent blog blogging configure configuring download downloading install installing server wordpress nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Uploading videos to multiple video hosting sites using Tubemogul. Wed, 12 Dec 2007 08:34:12 -0800

Author: screencastcent
Added: Wed, 12 Dec 2007 08:34:12 -0800
Duration: 198

visit www.screencastcentral.com for more. Uploading videos to multiple video hosting sites using Tubemogul. In this screencast, I show you how to upload a video to several video hosting sites all in one go. (Youtube, Google, etc)

]]> gohostingmultipleoncesitesuploadvideos http://revver.com/video/524509/uploading-videos-to-multiple-video-hosting-sites-using-tubemogul/ http://revver.com/watch/524509 Uploading videos to multiple video hosting sites using Tubemogul. visit www.screencastcentral.com for more. Uploading videos to multiple video hosting sites using Tubemogul. In this screencast, I show you how to upload a video to several video hosting sites all in one go. (Youtube, Google, etc) visit www.screencastcentral.com for more. Uploading videos to multiple video hosting sites using Tubemogul. In this screencast, I show you how to upload a video to several video hosting sites all in one go. (Youtube, Google, etc) screencastcent screencastcent go hosting multiple once sites upload videos nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ MyPAYE - Add New Employee Form Wed, 12 Dec 2007 08:34:12 -0800

Author: screencastcent
Added: Wed, 12 Dec 2007 08:34:12 -0800
Duration: 348

visit www.screencastcentral.com for more. In this screencast Ian explains how to use the \"Add New Employee Form\" rather than the wizard. The video shows how the same employee information is gathered.

]]> addemployeemymypayenewpaye http://revver.com/video/524521/mypaye-add-new-employee-form/ http://revver.com/watch/524521 MyPAYE - Add New Employee Form visit www.screencastcentral.com for more. In this screencast Ian explains how to use the \"Add New Employee Form\" rather than the wizard. The video shows how the same employee information is gathered. visit www.screencastcentral.com for more. In this screencast Ian explains how to use the \"Add New Employee Form\" rather than the wizard. The video shows how the same employee information is gathered. screencastcent screencastcent add employee my mypaye new paye nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ MyPAYE - Setting up a monthly payroll Wed, 12 Dec 2007 08:34:12 -0800

Author: screencastcent
Added: Wed, 12 Dec 2007 08:34:12 -0800
Duration: 159

visit www.screencastcentral.com for more. In this step we discover how to set up the monthly payroll for a business when using MyPAYE.

]]> mymypayenewpayepayrollsetsettingup http://revver.com/video/524524/mypaye-setting-up-a-monthly-payroll/ http://revver.com/watch/524524 MyPAYE - Setting up a monthly payroll visit www.screencastcentral.com for more. In this step we discover how to set up the monthly payroll for a business when using MyPAYE. visit www.screencastcentral.com for more. In this step we discover how to set up the monthly payroll for a business when using MyPAYE. screencastcent screencastcent my mypaye new paye payroll set setting up nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ +New Employee To Your MyPAYE Online Payroll Easily, Using The Add Employee Wizard Wed, 12 Dec 2007 08:34:12 -0800

Author: screencastcent
Added: Wed, 12 Dec 2007 08:34:12 -0800
Duration: 582

visit www.screencastcentral.com for more. Continuing the series on setting up a MyPAYE account to automate payroll, the next stage is to begin adding employees to your account

]]> accountaddemployeemymypayenewpaye http://revver.com/video/524534/new-employee-to-your-mypaye-online-payroll-easily-using-the-add-employee-wizard/ http://revver.com/watch/524534 +New Employee To Your MyPAYE Online Payroll Easily, Using The Add Employee Wizard visit www.screencastcentral.com for more. Continuing the series on setting up a MyPAYE account to automate payroll, the next stage is to begin adding employees to your account visit www.screencastcentral.com for more. Continuing the series on setting up a MyPAYE account to automate payroll, the next stage is to begin adding employees to your account screencastcent screencastcent account add employee my mypaye new paye nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Why UK payroll service providers should consider MyPAYE as their online software partner. Wed, 12 Dec 2007 08:34:12 -0800

Author: screencastcent
Added: Wed, 12 Dec 2007 08:34:12 -0800
Duration: 1157

visit www.screencastcentral.com for more. Why UK payroll service providers should consider MyPAYE as their online software partner. Watch this screencast to see how you can run an online payroll service - powered by MyPAYE!

]]> considermymypayeonlinepartnerpayepayrollprovidersservicesoftwareukwhy http://revver.com/video/524542/why-uk-payroll-service-providers-should-consider-mypaye-as-their-online-software-partner/ http://revver.com/watch/524542 Why UK payroll service providers should consider MyPAYE as their online software partner. visit www.screencastcentral.com for more. Why UK payroll service providers should consider MyPAYE as their online software partner. Watch this screencast to see how you can run an online payroll service - powered by MyPAYE! visit www.screencastcentral.com for more. Why UK payroll service providers should consider MyPAYE as their online software partner. Watch this screencast to see how you can run an online payroll service - powered by MyPAYE! screencastcent screencastcent consider my mypaye online partner paye payroll providers service software uk why nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ How to create a hotmail e-mail account. Wed, 12 Dec 2007 05:40:10 -0800

Author: screencastcent
Added: Wed, 12 Dec 2007 05:40:10 -0800
Duration: 265

visit www.screencast central.com for more. In this screencast, I show you how you can create a new e-mail account with Hotmail.

]]> createhotmailsign-up http://revver.com/video/524368/how-to-create-a-hotmail-e-mail-account/ http://revver.com/watch/524368 How to create a hotmail e-mail account. visit www.screencast central.com for more. In this screencast, I show you how you can create a new e-mail account with Hotmail. visit www.screencast central.com for more. In this screencast, I show you how you can create a new e-mail account with Hotmail. screencastcent screencastcent create hotmail sign-up nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ How to create a hotmail e-mail account. Wed, 12 Dec 2007 05:40:10 -0800

Author: screencastcent
Added: Wed, 12 Dec 2007 05:40:10 -0800
Duration: 265

visit www.screencastcentral.com for more. In this screencast, I show you how to create a new Hotmail e-mail account from scratch.

]]> createhotmailsign-up http://revver.com/video/524383/how-to-create-a-hotmail-e-mail-account/ http://revver.com/watch/524383 How to create a hotmail e-mail account. visit www.screencastcentral.com for more. In this screencast, I show you how to create a new Hotmail e-mail account from scratch. visit www.screencastcentral.com for more. In this screencast, I show you how to create a new Hotmail e-mail account from scratch. screencastcent screencastcent create hotmail sign-up nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Save time- Keyboard shortcuts shown using On-Screen Keyboard Tue, 11 Dec 2007 09:40:14 -0800

Author: screencastcent
Added: Tue, 11 Dec 2007 09:40:14 -0800
Duration: 85

visit www.screencastcentral.com for more. I wanted to demonstrate the shortcut in action. I launched Microsoft OS Keyboard & typed in the shortcuts with it. You can see the keys I hit & how they powered the shortcut on the text in my Wodpress blog.

]]> keyboardon-screenonscreensavescreenshortcutstime http://revver.com/video/522865/save-time-keyboard-shortcuts-shown-using-on-screen-keyboard/ http://revver.com/watch/522865 Save time- Keyboard shortcuts shown using On-Screen Keyboard visit www.screencastcentral.com for more. I wanted to demonstrate the shortcut in action. I launched Microsoft OS Keyboard & typed in the shortcuts with it. You can see the keys I hit & how they powered the shortcut on the text in my Wodpress blog. visit www.screencastcentral.com for more. I wanted to demonstrate the shortcut in action. I launched Microsoft OS Keyboard & typed in the shortcuts with it. You can see the keys I hit & how they powered the shortcut on the text in my Wodpress blog. screencastcent screencastcent keyboard on-screen onscreen save screen shortcuts time nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Here's how to take SmugMug, a photo hosting service, for a 14 day test run, plus a coupon to save $5 if you decide to stay on! Tue, 11 Dec 2007 09:40:14 -0800

Author: screencastcent
Added: Tue, 11 Dec 2007 09:40:14 -0800
Duration: 175

visit www.screencastcentral.com for more. This screencast shows how to sign up for the 14 day free trial at SmugMug.

]]> hostingphtosaveservicesmugmugtest http://revver.com/video/522874/heres-how-to-take-smugmug-a-photo-hosting-service-for-a-14-day-test-run-plus-a-coupon-to-save-5-if-you-decide-to-stay-on/ http://revver.com/watch/522874 Here's how to take SmugMug, a photo hosting service, for a 14 day test run, plus a coupon to save $5 if you decide to stay on! visit www.screencastcentral.com for more. This screencast shows how to sign up for the 14 day free trial at SmugMug. visit www.screencastcentral.com for more. This screencast shows how to sign up for the 14 day free trial at SmugMug. screencastcent screencastcent hosting phto save service smugmug test nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ What is a screencast? Tue, 11 Dec 2007 09:40:14 -0800

Author: screencastcent
Added: Tue, 11 Dec 2007 09:40:14 -0800
Duration: 139

visit www.screencastcentral.com for more. I thought I would create a screencast to show what a screencast is. It's quicker to do that than to type a document, create a tutorial, write a blog post... and you get to see what a screencast looks like!

]]> screencast http://revver.com/video/522899/what-is-a-screencast/ http://revver.com/watch/522899 What is a screencast? visit www.screencastcentral.com for more. I thought I would create a screencast to show what a screencast is. It's quicker to do that than to type a document, create a tutorial, write a blog post... and you get to see what a screencast looks like! visit www.screencastcentral.com for more. I thought I would create a screencast to show what a screencast is. It's quicker to do that than to type a document, create a tutorial, write a blog post... and you get to see what a screencast looks like! screencastcent screencastcent screencast nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Setting Multiple Home Pages in Mozilla Firefox 2.0 Tue, 11 Dec 2007 09:19:07 -0800

Author: screencastcent
Added: Tue, 11 Dec 2007 09:19:07 -0800
Duration: 97

visit www.screencastcentral.com for more. In this screencast, we show you how to automatically set your browser to automatically open pages in multiple tabs in Firefox.

]]> 2.0firefoxhmehomepagemozillamultiplepageset http://revver.com/video/522762/setting-multiple-home-pages-in-mozilla-firefox-20/ http://revver.com/watch/522762 Setting Multiple Home Pages in Mozilla Firefox 2.0 visit www.screencastcentral.com for more. In this screencast, we show you how to automatically set your browser to automatically open pages in multiple tabs in Firefox. visit www.screencastcentral.com for more. In this screencast, we show you how to automatically set your browser to automatically open pages in multiple tabs in Firefox. screencastcent screencastcent 2.0 firefox hme homepage mozilla multiple page set nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ AVG Anti-Virus - Protect your Computer against Viruses for Free Tue, 11 Dec 2007 09:19:07 -0800

Author: screencastcent
Added: Tue, 11 Dec 2007 09:19:07 -0800
Duration: 243

visit www.screencastcentral.com for more. In this tutorial we guide you through the process of installing AVG on your PC, & then demonstrate the 1st run wizard, which allows you to update the program, and set the level of protection for your system.

]]> anti-virusavgfreeinstallprotectsetupvirus http://revver.com/video/522768/avg-anti-virus-protect-your-computer-against-viruses-for-free/ http://revver.com/watch/522768 AVG Anti-Virus - Protect your Computer against Viruses for Free visit www.screencastcentral.com for more. In this tutorial we guide you through the process of installing AVG on your PC, & then demonstrate the 1st run wizard, which allows you to update the program, and set the level of protection for your system. visit www.screencastcentral.com for more. In this tutorial we guide you through the process of installing AVG on your PC, & then demonstrate the 1st run wizard, which allows you to update the program, and set the level of protection for your system. screencastcent screencastcent anti-virus avg free install protect setup virus nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ How To Use Jing to Create Video Screen Captures - A Screencast Tutorial Tue, 11 Dec 2007 09:19:07 -0800

Author: screencastcent
Added: Tue, 11 Dec 2007 09:19:07 -0800
Duration: 112

visit www.screencastcentral.com for more. This screencast walks you through the rest of the steps to make a Jing screencast...

]]> capturecreatejingscreentutorialusevideo http://revver.com/video/522776/how-to-use-jing-to-create-video-screen-captures-a-screencast-tutorial/ http://revver.com/watch/522776 How To Use Jing to Create Video Screen Captures - A Screencast Tutorial visit www.screencastcentral.com for more. This screencast walks you through the rest of the steps to make a Jing screencast... visit www.screencastcentral.com for more. This screencast walks you through the rest of the steps to make a Jing screencast... screencastcent screencastcent capture create jing screen tutorial use video nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Blogging for Beginners - Managing Existing, and Creating Your First Posts Tue, 11 Dec 2007 09:19:07 -0800

Author: screencastcent
Added: Tue, 11 Dec 2007 09:19:07 -0800
Duration: 113

visit www.screencastcentral.com for more. In this screencast, we show you how to remove the initial 'Hello World' post, and guide you through the process of creating your own first post.

]]> 1stblogbloggingcreatecreatingexistingfirstmanagemanagingpostposts http://revver.com/video/522780/blogging-for-beginners-managing-existing-and-creating-your-first-posts/ http://revver.com/watch/522780 Blogging for Beginners - Managing Existing, and Creating Your First Posts visit www.screencastcentral.com for more. In this screencast, we show you how to remove the initial 'Hello World' post, and guide you through the process of creating your own first post. visit www.screencastcentral.com for more. In this screencast, we show you how to remove the initial 'Hello World' post, and guide you through the process of creating your own first post. screencastcent screencastcent 1st blog blogging create creating existing first manage managing post posts nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Create a Cool Web2.0 Style Buttons for your Website For Free Tue, 11 Dec 2007 09:19:07 -0800

Author: screencastcent
Added: Tue, 11 Dec 2007 09:19:07 -0800
Duration: 176

visit www.screencastcentral.com for more. In this screencast tutorial, I demonstrate a great web-based ap-on-tap that you can use to create great looking, Web 2.0 style buttons for free.

]]> 2.0buttoncoolcreatefreestylewebwebsite http://revver.com/video/522796/create-a-cool-web20-style-buttons-for-your-website-for-free/ http://revver.com/watch/522796 Create a Cool Web2.0 Style Buttons for your Website For Free visit www.screencastcentral.com for more. In this screencast tutorial, I demonstrate a great web-based ap-on-tap that you can use to create great looking, Web 2.0 style buttons for free. visit www.screencastcentral.com for more. In this screencast tutorial, I demonstrate a great web-based ap-on-tap that you can use to create great looking, Web 2.0 style buttons for free. screencastcent screencastcent 2.0 button cool create free style web website nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Howto Open Comma Separated Variable Files (Open Office Calc) Tue, 11 Dec 2007 09:19:07 -0800

Author: screencastcent
Added: Tue, 11 Dec 2007 09:19:07 -0800
Duration: 87

visit www.screencastcentral.com for more. In this screencast tutorial, we show you how to successfully open .csv files in Open Office Calc, so that you can restore the original structure of the spreadsheet.

]]> calccommacsvfilesofficeopenseparatedvariables http://revver.com/video/522802/howto-open-comma-separated-variable-files-open-office-calc/ http://revver.com/watch/522802 Howto Open Comma Separated Variable Files (Open Office Calc) visit www.screencastcentral.com for more. In this screencast tutorial, we show you how to successfully open .csv files in Open Office Calc, so that you can restore the original structure of the spreadsheet. visit www.screencastcentral.com for more. In this screencast tutorial, we show you how to successfully open .csv files in Open Office Calc, so that you can restore the original structure of the spreadsheet. screencastcent screencastcent calc comma csv files office open separated variables nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Protecting a Section of Text when using Open Office Writer Tue, 11 Dec 2007 09:19:07 -0800

Author: screencastcent
Added: Tue, 11 Dec 2007 09:19:07 -0800
Duration: 83

visit www.screencastcentral.com for more. In this screencast tutorial, we show you how to protect a section of text when using Open Office Writer, including applying a password which will protect your document against unauthorised editing.

]]> officeopenprotectingsectiontextwriter http://revver.com/video/522805/protecting-a-section-of-text-when-using-open-office-writer/ http://revver.com/watch/522805 Protecting a Section of Text when using Open Office Writer visit www.screencastcentral.com for more. In this screencast tutorial, we show you how to protect a section of text when using Open Office Writer, including applying a password which will protect your document against unauthorised editing. visit www.screencastcentral.com for more. In this screencast tutorial, we show you how to protect a section of text when using Open Office Writer, including applying a password which will protect your document against unauthorised editing. screencastcent screencastcent office open protecting section text writer nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ +Transitions SlideShow Presentations (Open Office Impress) Tue, 11 Dec 2007 09:19:07 -0800

Author: screencastcent
Added: Tue, 11 Dec 2007 09:19:07 -0800
Duration: 106

visit www.screencastcentral.com for more. In this screencast tutorial, we show you how to quickly add different types of transition, and modify the settings for when they occur.

]]> &addimpressofficeopenpresentationsshowslideslideshowtransitions http://revver.com/video/522813/transitions-slideshow-presentations-open-office-impress/ http://revver.com/watch/522813 +Transitions SlideShow Presentations (Open Office Impress) visit www.screencastcentral.com for more. In this screencast tutorial, we show you how to quickly add different types of transition, and modify the settings for when they occur. visit www.screencastcentral.com for more. In this screencast tutorial, we show you how to quickly add different types of transition, and modify the settings for when they occur. screencastcent screencastcent & add impress office open presentations show slide slideshow transitions nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Blogging for Beginners - Downloading, Configuring and Installing Wordpress on your Web Server Tue, 11 Dec 2007 09:19:07 -0800

Author: screencastcent
Added: Tue, 11 Dec 2007 09:19:07 -0800
Duration: 217

visit www.screencastcentral.com for more. In this tutorial we guide you through the download process, editing the source files to make a connection to your database, uploading the files to the server, & finally through the installation process itself

]]> blogbloggingconfigureconfiguringdownloaddownloadinginstallingserverwebwordpress http://revver.com/video/522822/blogging-for-beginners-downloading-configuring-and-installing-wordpress-on-your-web-server/ http://revver.com/watch/522822 Blogging for Beginners - Downloading, Configuring and Installing Wordpress on your Web Server visit www.screencastcentral.com for more. In this tutorial we guide you through the download process, editing the source files to make a connection to your database, uploading the files to the server, & finally through the installation process itself visit www.screencastcentral.com for more. In this tutorial we guide you through the download process, editing the source files to make a connection to your database, uploading the files to the server, & finally through the installation process itself screencastcent screencastcent blog blogging configure configuring download downloading installing server web wordpress nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Using Word Count to see Document Stats (open office writer) Tue, 11 Dec 2007 09:19:07 -0800

Author: screencastcent
Added: Tue, 11 Dec 2007 09:19:07 -0800
Duration: 56

visit www.screencastcentral.com for more. In this screencast tutorial, we show you how to use the built-in word count feature of Open Office Writer, to accurately check your document statistics.

]]> countdocumentofficeopenstatisticsuseusingviewwordwordcountwriter http://revver.com/video/522829/using-word-count-to-see-document-stats-open-office-writer/ http://revver.com/watch/522829 Using Word Count to see Document Stats (open office writer) visit www.screencastcentral.com for more. In this screencast tutorial, we show you how to use the built-in word count feature of Open Office Writer, to accurately check your document statistics. visit www.screencastcentral.com for more. In this screencast tutorial, we show you how to use the built-in word count feature of Open Office Writer, to accurately check your document statistics. screencastcent screencastcent count document office open statistics use using view word wordcount writer nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bubbleply - easily add cmnts, images, &hyperlinks to vids. Tue, 11 Dec 2007 09:19:07 -0800

Author: screencastcent
Added: Tue, 11 Dec 2007 09:19:07 -0800
Duration: 223

visit www.screencastcentral.com for more. Here's a quick introduction & an example of using Bubbleply to spruce up a video

]]> addbubblebubbleplycommentseasilyeasyhostinghyperlinksimagesplysitesvideo http://revver.com/video/522834/bubbleply-easily-add-cmnts-images-hyperlinks-to-vids/ http://revver.com/watch/522834 Bubbleply - easily add cmnts, images, &hyperlinks to vids. visit www.screencastcentral.com for more. Here's a quick introduction & an example of using Bubbleply to spruce up a video visit www.screencastcentral.com for more. Here's a quick introduction & an example of using Bubbleply to spruce up a video screencastcent screencastcent add bubble bubbleply comments easily easy hosting hyperlinks images ply sites video nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ How to buy a domain name from GoDaddy and get top discounts, by searching Google for GoDaddy Coupons Tue, 11 Dec 2007 09:19:07 -0800

Author: screencastcent
Added: Tue, 11 Dec 2007 09:19:07 -0800
Duration: 71

visit www.screencastcentral.com for more. Here's a screencast on buying a \"dot com\" domain name from Godaddy and getting a discount from $8.99 to $6.99.

]]> buycouponsdiscountsdomaingodaddygooglenamepurchasesearch http://revver.com/video/522847/how-to-buy-a-domain-name-from-godaddy-and-get-top-discounts-by-searching-google-for-godaddy-coupons/ http://revver.com/watch/522847 How to buy a domain name from GoDaddy and get top discounts, by searching Google for GoDaddy Coupons visit www.screencastcentral.com for more. Here's a screencast on buying a \"dot com\" domain name from Godaddy and getting a discount from $8.99 to $6.99. visit www.screencastcentral.com for more. Here's a screencast on buying a \"dot com\" domain name from Godaddy and getting a discount from $8.99 to $6.99. screencastcent screencastcent buy coupons discounts domain godaddy google name purchase search nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ & Your businees to google-maps. Easy tutorial. Tue, 11 Dec 2007 09:19:07 -0800

Author: screencastcent
Added: Tue, 11 Dec 2007 09:19:07 -0800
Duration: 124

visit www.screencastcentral.com for more. Here's how to make sure google has the correct information about your business.

]]> addbusinesseasygooglegoogle-mapsmapstutorial http://revver.com/video/522854/your-businees-to-google-maps-easy-tutorial/ http://revver.com/watch/522854 & Your businees to google-maps. Easy tutorial. visit www.screencastcentral.com for more. Here's how to make sure google has the correct information about your business. visit www.screencastcentral.com for more. Here's how to make sure google has the correct information about your business. screencastcent screencastcent add business easy google google-maps maps tutorial nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ How to Restore Files & Folders to your PC from a Backup File Tue, 11 Dec 2007 07:25:11 -0800

Author: screencastcent
Added: Tue, 11 Dec 2007 07:25:11 -0800
Duration: 92

visit www.screencastcentral.com for more. In this screencast, we show you how to restore your files and folders to their original location on your PC, from a backup file, using the Windows XP Backup and Restore Wizard.

]]> back-upbackupfilesfolderspcrestore http://revver.com/video/522755/how-to-restore-files-folders-to-your-pc-from-a-backup-file/ http://revver.com/watch/522755 How to Restore Files & Folders to your PC from a Backup File visit www.screencastcentral.com for more. In this screencast, we show you how to restore your files and folders to their original location on your PC, from a backup file, using the Windows XP Backup and Restore Wizard. visit www.screencastcentral.com for more. In this screencast, we show you how to restore your files and folders to their original location on your PC, from a backup file, using the Windows XP Backup and Restore Wizard. screencastcent screencastcent back-up backup files folders pc restore nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Adding Virtual CD and DVD Drives to your PC, using Alcohol 120% Tue, 11 Dec 2007 07:25:11 -0800

Author: screencastcent
Added: Tue, 11 Dec 2007 07:25:11 -0800
Duration: 117

StevenH Alcohol 120% is an application that you can use to add virtual CD and DVD drives to your computer. You can then use these drives to play Disc Images, stored on your computer's hard disc drive, without having to burn them onto a CD or ...

]]> %120addalcoholdcdrivesdvdpcvirtual http://revver.com/video/522626/adding-virtual-cd-and-dvd-drives-to-your-pc-using-alcohol-120/ http://revver.com/watch/522626 Adding Virtual CD and DVD Drives to your PC, using Alcohol 120% StevenH Alcohol 120% is an application that you can use to add virtual CD and DVD drives to your computer. You can then use these drives to play Disc Images, stored on your computer's hard disc drive, without having to burn them onto a CD or ... StevenH Alcohol 120% is an application that you can use to add virtual CD and DVD drives to your computer. You can then use these drives to play Disc Images, stored on your computer's hard disc drive, without having to burn them onto a CD or ... screencastcent