Videos by travelchannel Videos by travelchannel http://revver.com/u/travelchannel/ http://revver.com webmaster@revver.com Madventures - Yage Mado Hallucinogen in Brazil Wed, 23 Sep 2009 20:16:29 -0800

Author: travelchannel
Added: Wed, 23 Sep 2009 20:16:29 -0800
Duration: 0

Riku and Tunna head to Tabatinga, where they investigate the medicine and herbals used in the Ayahuasca Retreat and experience a ritual meant to help people face and conquer their darkest fears. Catch the series premiere of Madventures on Monday, September 21st, at 10 E/P. For more information visit: http://www.travelchannel.com/madventures

]]> brazilchanneldrugfearhallucinogenmadomadventurespremiereretreatritualseriesshamantraveltvyage http://revver.com/video/1932693/madventures-yage-mado-hallucinogen-in-brazil/ http://revver.com/watch/1932693 Madventures - Yage Mado Hallucinogen in Brazil Riku and Tunna head to Tabatinga, where they investigate the medicine and herbals used in the Ayahuasca Retreat and experience a ritual meant to help people face and conquer their darkest fears. Catch the series premiere of Madventures on Monday, September 21st, at 10 E/P. For more information visit: http://www.travelchannel.com/madventures Riku and Tunna head to Tabatinga, where they investigate the medicine and herbals used in the Ayahuasca Retreat and experience a ritual meant to help people face and conquer their darkest fears. Catch the series premiere of Madventures on Monday, September 21st, at 10 E/P. For more information visit: http://www.travelchannel.com/madventures travelchannel travelchannel brazil channel drug fear hallucinogen mado madventures premiere retreat ritual series shaman travel tv yage nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Man v. Food - Mac Daddy Pancakes Wed, 16 Sep 2009 13:35:10 -0800

Author: travelchannel
Added: Wed, 16 Sep 2009 13:35:10 -0800
Duration: 0

Adam ventures across the pacific to Honolulu where he visits MAC 24-7, home of mac daddy pancakes the size of manholes. These giant creations are topped with a huge selection of treats including chocolate chips, blueberries, shredded coconut, and pineapple. All new episodes of Man v. Food air Wednesdays at 10pm E/P only on Travel Channel. www.travelchannel.com/TV_Shows/Man_v_Food

]]> 247adamblueberriesbreakfastchallengechannelcoconutdaddyfoodhawaiihonoluluislandmacmanpacificpancakespineapplerichmantravelversusvs http://revver.com/video/1907043/man-v-food-mac-daddy-pancakes/ http://revver.com/watch/1907043 Man v. Food - Mac Daddy Pancakes Adam ventures across the pacific to Honolulu where he visits MAC 24-7, home of mac daddy pancakes the size of manholes. These giant creations are topped with a huge selection of treats including chocolate chips, blueberries, shredded coconut, and pineapple. All new episodes of Man v. Food air Wednesdays at 10pm E/P only on Travel Channel. www.travelchannel.com/TV_Shows/Man_v_Food Adam ventures across the pacific to Honolulu where he visits MAC 24-7, home of mac daddy pancakes the size of manholes. These giant creations are topped with a huge selection of treats including chocolate chips, blueberries, shredded coconut, and pineapple. All new episodes of Man v. Food air Wednesdays at 10pm E/P only on Travel Channel. www.travelchannel.com/TV_Shows/Man_v_Food travelchannel travelchannel 24 7 adam blueberries breakfast challenge channel coconut daddy food hawaii honolulu island mac man pacific pancakes pineapple richman travel versus vs nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Anthony Bourdain - Pane Carasau In Sardinia Wed, 16 Sep 2009 13:35:10 -0800

Author: travelchannel
Added: Wed, 16 Sep 2009 13:35:10 -0800
Duration: 0

Tony travels to his wife's homeland of Sardinia, where he watches several women knead and bake Pane Carasau -- a crispy, layered flat-bread that can be traced back many generations. New episodes of Anthony Bourdain: No Reservations air Mondays at 10PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Anthony_Bourdain

]]> anthonybourdainbreadcarasauchannelcriticeatfooditalynopanereservationssardiniatravel http://revver.com/video/1915623/anthony-bourdain-pane-carasau-in-sardinia/ http://revver.com/watch/1915623 Anthony Bourdain - Pane Carasau In Sardinia Tony travels to his wife's homeland of Sardinia, where he watches several women knead and bake Pane Carasau -- a crispy, layered flat-bread that can be traced back many generations. New episodes of Anthony Bourdain: No Reservations air Mondays at 10PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Anthony_Bourdain Tony travels to his wife's homeland of Sardinia, where he watches several women knead and bake Pane Carasau -- a crispy, layered flat-bread that can be traced back many generations. New episodes of Anthony Bourdain: No Reservations air Mondays at 10PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Anthony_Bourdain travelchannel travelchannel anthony bourdain bread carasau channel critic eat food italy no pane reservations sardinia travel nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Anthony Bourdain - Tortilla Factory In Brooklyn Sun, 06 Sep 2009 17:55:57 -0800

Author: travelchannel
Added: Sun, 06 Sep 2009 17:55:57 -0800
Duration: 0

Tony takes a trip through the outer boroughs of NYC and stops by Tortilleria Mexicana Los Hermanos -- a small tortilla factory that also serves authentic mexican food from its storefront. New episodes of Anthony Bourdain: No Reservations air Mondays at 10PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Anthony_Bourdain

]]> anthonyauthenticboroughsbourdainbrooklynchannelchefcitycriticeatfactoryfoodmanhattanmexicannewnonycouterreservationsrestauranttortillastravelyork http://revver.com/video/1899793/anthony-bourdain-tortilla-factory-in-brooklyn/ http://revver.com/watch/1899793 Anthony Bourdain - Tortilla Factory In Brooklyn Tony takes a trip through the outer boroughs of NYC and stops by Tortilleria Mexicana Los Hermanos -- a small tortilla factory that also serves authentic mexican food from its storefront. New episodes of Anthony Bourdain: No Reservations air Mondays at 10PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Anthony_Bourdain Tony takes a trip through the outer boroughs of NYC and stops by Tortilleria Mexicana Los Hermanos -- a small tortilla factory that also serves authentic mexican food from its storefront. New episodes of Anthony Bourdain: No Reservations air Mondays at 10PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Anthony_Bourdain travelchannel travelchannel anthony authentic boroughs bourdain brooklyn channel chef city critic eat factory food manhattan mexican new no nyc outer reservations restaurant tortillas travel york nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Anthony Bourdain - Tony's Favorite Critter Tue, 01 Sep 2009 18:38:14 -0800

Author: travelchannel
Added: Tue, 01 Sep 2009 18:38:14 -0800
Duration: 0

Tony fields a burning question about his favorite meal in the animal kingdom, and choses armadillo as his top pick. New episodes of Anthony Bourdain: No Reservations air Mondays at 10PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Anthony_Bourdain

]]> anthonyarmadillobestbourdainburningchannelcriticeatepisodesfoodmomentsnopicksquestionsreservationstravelweb http://revver.com/video/1890103/anthony-bourdain-tonys-favorite-critter/ http://revver.com/watch/1890103 Anthony Bourdain - Tony's Favorite Critter Tony fields a burning question about his favorite meal in the animal kingdom, and choses armadillo as his top pick. New episodes of Anthony Bourdain: No Reservations air Mondays at 10PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Anthony_Bourdain Tony fields a burning question about his favorite meal in the animal kingdom, and choses armadillo as his top pick. New episodes of Anthony Bourdain: No Reservations air Mondays at 10PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Anthony_Bourdain travelchannel travelchannel anthony armadillo best bourdain burning channel critic eat episodes food moments no picks questions reservations travel web nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Anthony Bourdain - Montana "Top Of The World" Ride Wed, 26 Aug 2009 05:52:34 -0800

Author: travelchannel
Added: Wed, 26 Aug 2009 05:52:34 -0800
Duration: 0

While journeying through Montana, Tony helps a rancher lasso and tag young calves on the open rage. New episodes of Anthony Bourdain: No Reservations air Mondays at 10PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Anthony_Bourdain

]]> anthonybourdaincalfcalveschannelcowboycowscriticeatfoodhillslassomontanamountainsnaturenoopenplainsrangereservationstagtaggingtravel http://revver.com/video/1876249/anthony-bourdain-montana-top-of-the-world-ride/ http://revver.com/watch/1876249 Anthony Bourdain - Montana "Top Of The World" Ride While journeying through Montana, Tony helps a rancher lasso and tag young calves on the open rage. New episodes of Anthony Bourdain: No Reservations air Mondays at 10PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Anthony_Bourdain While journeying through Montana, Tony helps a rancher lasso and tag young calves on the open rage. New episodes of Anthony Bourdain: No Reservations air Mondays at 10PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Anthony_Bourdain travelchannel travelchannel anthony bourdain calf calves channel cowboy cows critic eat food hills lasso montana mountains nature no open plains range reservations tag tagging travel nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bizarre World - The Culture Of Cuba Wed, 26 Aug 2009 05:52:34 -0800

Author: travelchannel
Added: Wed, 26 Aug 2009 05:52:34 -0800
Duration: 0

In the series premiere of Bizarre World, Andrew gets a guided tour of the landmarks and culture of Cuba including old American cars and taxis. Andrew's exploration of the bizarre begins Tuesday, September 1st at 10PM E/P, only on Travel Channel. www.travelchannel.com/TV_Shows/Bizarre_World

]]> adventureandrewbizarrechannelchecubacubancultureexplorationfoodguevaramaleconnewseriesshowtravelworldzimmern http://revver.com/video/1879378/bizarre-world-the-culture-of-cuba/ http://revver.com/watch/1879378 Bizarre World - The Culture Of Cuba In the series premiere of Bizarre World, Andrew gets a guided tour of the landmarks and culture of Cuba including old American cars and taxis. Andrew's exploration of the bizarre begins Tuesday, September 1st at 10PM E/P, only on Travel Channel. www.travelchannel.com/TV_Shows/Bizarre_World In the series premiere of Bizarre World, Andrew gets a guided tour of the landmarks and culture of Cuba including old American cars and taxis. Andrew's exploration of the bizarre begins Tuesday, September 1st at 10PM E/P, only on Travel Channel. www.travelchannel.com/TV_Shows/Bizarre_World travelchannel travelchannel adventure andrew bizarre channel che cuba cuban culture exploration food guevara malecon new series show travel world zimmern nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Man v. Food - Spicy Tuna Hand Roll Challenge Wed, 19 Aug 2009 09:55:48 -0800

Author: travelchannel
Added: Wed, 19 Aug 2009 09:55:48 -0800
Duration: 0

Adam stops by Bushido's in Charleston, South Carolina, where he hones his eating skills to take on the notorious spicy tuna hand roll challenge. All new episodes of Man v. Food air Wednesdays at 10pm E/P only on Travel Channel. www.travelchannel.com/TV_Shows/Man_v_Food

]]> adambushidocarolinachallengechannelcharlestonfishfoodmanrawrestaurantrichmanscsouthspicysushitraveltunaversusvs http://revver.com/video/1860267/man-v-food-spicy-tuna-hand-roll-challenge/ http://revver.com/watch/1860267 Man v. Food - Spicy Tuna Hand Roll Challenge Adam stops by Bushido's in Charleston, South Carolina, where he hones his eating skills to take on the notorious spicy tuna hand roll challenge. All new episodes of Man v. Food air Wednesdays at 10pm E/P only on Travel Channel. www.travelchannel.com/TV_Shows/Man_v_Food Adam stops by Bushido's in Charleston, South Carolina, where he hones his eating skills to take on the notorious spicy tuna hand roll challenge. All new episodes of Man v. Food air Wednesdays at 10pm E/P only on Travel Channel. www.travelchannel.com/TV_Shows/Man_v_Food travelchannel travelchannel adam bushido carolina challenge channel charleston fish food man raw restaurant richman sc south spicy sushi travel tuna versus vs nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Anthony Bourdain - Train vs. Marketplace Sat, 15 Aug 2009 01:52:43 -0800

Author: travelchannel
Added: Sat, 15 Aug 2009 01:52:43 -0800
Duration: 0

Tony visits a rural market in Thailand where the local train cuts right through the bustling crowd of anxious shoppers and food stalls. New episodes of Anthony Bourdain: No Reservations air Mondays at 10PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Anthony_Bourdain

]]> accidentanthonyasainasiabourdainchannelcriticeatfarmersfishfoodfreshmarketnoplaceproducereservationsshoppersstallsstationthailandtraintravel http://revver.com/video/1852672/anthony-bourdain-train-vs-marketplace/ http://revver.com/watch/1852672 Anthony Bourdain - Train vs. Marketplace Tony visits a rural market in Thailand where the local train cuts right through the bustling crowd of anxious shoppers and food stalls. New episodes of Anthony Bourdain: No Reservations air Mondays at 10PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Anthony_Bourdain Tony visits a rural market in Thailand where the local train cuts right through the bustling crowd of anxious shoppers and food stalls. New episodes of Anthony Bourdain: No Reservations air Mondays at 10PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Anthony_Bourdain travelchannel travelchannel accident anthony asain asia bourdain channel critic eat farmers fish food fresh market no place produce reservations shoppers stalls station thailand train travel nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Sam Brown - Pressing Records in Nashville Sat, 15 Aug 2009 01:52:43 -0800

Author: travelchannel
Added: Sat, 15 Aug 2009 01:52:43 -0800
Duration: 0

Sam stops by United Record Press in Nashville, Tennessee, where she gets a behind-the-scenes look at the time-honored tradition of pressing records from an old pro. New episodes of Samantha Brown's Great Weekends air Saturdays at 10PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Samantha_Brown

]]> brownchannelgreatmassmusicnashvillepressingproductionrecordsamsamanthaseriestennesseetravelvacationweekends http://revver.com/video/1852655/sam-brown-pressing-records-in-nashville/ http://revver.com/watch/1852655 Sam Brown - Pressing Records in Nashville Sam stops by United Record Press in Nashville, Tennessee, where she gets a behind-the-scenes look at the time-honored tradition of pressing records from an old pro. New episodes of Samantha Brown's Great Weekends air Saturdays at 10PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Samantha_Brown Sam stops by United Record Press in Nashville, Tennessee, where she gets a behind-the-scenes look at the time-honored tradition of pressing records from an old pro. New episodes of Samantha Brown's Great Weekends air Saturdays at 10PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Samantha_Brown travelchannel travelchannel brown channel great mass music nashville pressing production record sam samantha series tennessee travel vacation weekends nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Man v. Food - The B3 Burrito Challenge in Vegas Thu, 13 Aug 2009 05:52:34 -0800

Author: travelchannel
Added: Thu, 13 Aug 2009 05:52:34 -0800
Duration: 0

Adam takes on one of Sin City's wildest food creations: The Big Badass Burrito at the NASCAR Cafe. This monster is loaded with beef, vegetables, nacho cheese, and topped with scoops of sour cream and guacamole. All new episodes of Man v. Food premiere Wednesday, August 5 at 10pm E/P only on Travel Channel. www.travelchannel.com/TV_Shows/Man_v_Food

]]> adamb3burritochallengechannelfoodlasmannevadarichmantravelvegasversusvs http://revver.com/video/1845802/man-v-food-the-b3-burrito-challenge-in-vegas/ http://revver.com/watch/1845802 Man v. Food - The B3 Burrito Challenge in Vegas Adam takes on one of Sin City's wildest food creations: The Big Badass Burrito at the NASCAR Cafe. This monster is loaded with beef, vegetables, nacho cheese, and topped with scoops of sour cream and guacamole. All new episodes of Man v. Food premiere Wednesday, August 5 at 10pm E/P only on Travel Channel. www.travelchannel.com/TV_Shows/Man_v_Food Adam takes on one of Sin City's wildest food creations: The Big Badass Burrito at the NASCAR Cafe. This monster is loaded with beef, vegetables, nacho cheese, and topped with scoops of sour cream and guacamole. All new episodes of Man v. Food premiere Wednesday, August 5 at 10pm E/P only on Travel Channel. www.travelchannel.com/TV_Shows/Man_v_Food travelchannel travelchannel adam b3 burrito challenge channel food las man nevada richman travel vegas versus vs nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Anthony Bourdain - Farmer's Market in San Francisco Tue, 11 Aug 2009 11:49:43 -0800

Author: travelchannel
Added: Tue, 11 Aug 2009 11:49:43 -0800
Duration: 0

Tony visits the Ferry Building Marketplace in San Francisco, where he samples blue cheese and a hearty plate of tamales. New episodes of Anthony Bourdain: No Reservations air Mondays at 10PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Anthony_Bourdain

]]> anthonybaybourdainbuildingchannelcriticeatfarmersferryfoodfranciscofreemarketmarketplacenoreservationssantamalestravel http://revver.com/video/1840396/anthony-bourdain-farmers-market-in-san-francisco/ http://revver.com/watch/1840396 Anthony Bourdain - Farmer's Market in San Francisco Tony visits the Ferry Building Marketplace in San Francisco, where he samples blue cheese and a hearty plate of tamales. New episodes of Anthony Bourdain: No Reservations air Mondays at 10PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Anthony_Bourdain Tony visits the Ferry Building Marketplace in San Francisco, where he samples blue cheese and a hearty plate of tamales. New episodes of Anthony Bourdain: No Reservations air Mondays at 10PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Anthony_Bourdain travelchannel travelchannel anthony bay bourdain building channel critic eat farmers ferry food francisco free market marketplace no reservations san tamales travel nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Sam Brown Visits Elvis' Teenage Home Fri, 07 Aug 2009 12:33:11 -0800

Author: travelchannel
Added: Fri, 07 Aug 2009 12:33:11 -0800
Duration: 0

While in Memphis, Sam Brown stops by Elvis' teenage home and takes a tour with The King's childhood friend. New episodes of Samantha Brown's Great Weekends air Saturdays at 10PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Samantha_Brown

]]> arcadebrownchannelelvisgracelandgreatkingmemphismusicsamsamanthaseriessouthtennesseetravelvacationweekends http://revver.com/video/1836335/sam-brown-visits-elvis-teenage-home/ http://revver.com/watch/1836335 Sam Brown Visits Elvis' Teenage Home While in Memphis, Sam Brown stops by Elvis' teenage home and takes a tour with The King's childhood friend. New episodes of Samantha Brown's Great Weekends air Saturdays at 10PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Samantha_Brown While in Memphis, Sam Brown stops by Elvis' teenage home and takes a tour with The King's childhood friend. New episodes of Samantha Brown's Great Weekends air Saturdays at 10PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Samantha_Brown travelchannel travelchannel arcade brown channel elvis graceland great king memphis music sam samantha series south tennessee travel vacation weekends nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Sam Brown Makes The Elvis Sandwich Fri, 07 Aug 2009 12:33:11 -0800

Author: travelchannel
Added: Fri, 07 Aug 2009 12:33:11 -0800
Duration: 0

Samantha Brown visits the Arcade Restaurant in Memphis, and dines in Elvis' favorite booth. New episodes of Samantha Brown's Great Weekends air Saturdays at 10PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Samantha_Brown

]]> arcadebrownchannelelvisgracelandgreatkingmemphismusicsamsamanthaseriessouthtennesseetravelvacationweekends http://revver.com/video/1836352/sam-brown-makes-the-elvis-sandwich/ http://revver.com/watch/1836352 Sam Brown Makes The Elvis Sandwich Samantha Brown visits the Arcade Restaurant in Memphis, and dines in Elvis' favorite booth. New episodes of Samantha Brown's Great Weekends air Saturdays at 10PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Samantha_Brown Samantha Brown visits the Arcade Restaurant in Memphis, and dines in Elvis' favorite booth. New episodes of Samantha Brown's Great Weekends air Saturdays at 10PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Samantha_Brown travelchannel travelchannel arcade brown channel elvis graceland great king memphis music sam samantha series south tennessee travel vacation weekends nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bite Me With Dr. Mike - The Slow Loris In Borneo Wed, 22 Jul 2009 07:50:38 -0800

Author: travelchannel
Added: Wed, 22 Jul 2009 07:50:38 -0800
Duration: 0

Dr. Mike sets out in the dead of night to find a small mammal known as the slow loris hidden away in Borneo's vast jungle. New episodes of Bite Me With Dr. Mike air Tuesday nights at 10PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Bite_Me_with_Dr_Mike

]]> biteborneocanopychanneldoctordrforestjunglelorismemikenocturnalrainslowtelevisiontraveltreestvvirologist http://revver.com/video/1805141/bite-me-with-dr-mike-the-slow-loris-in-borneo/ http://revver.com/watch/1805141 Bite Me With Dr. Mike - The Slow Loris In Borneo Dr. Mike sets out in the dead of night to find a small mammal known as the slow loris hidden away in Borneo's vast jungle. New episodes of Bite Me With Dr. Mike air Tuesday nights at 10PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Bite_Me_with_Dr_Mike Dr. Mike sets out in the dead of night to find a small mammal known as the slow loris hidden away in Borneo's vast jungle. New episodes of Bite Me With Dr. Mike air Tuesday nights at 10PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Bite_Me_with_Dr_Mike travelchannel travelchannel bite borneo canopy channel doctor dr forest jungle loris me mike nocturnal rain slow television travel trees tv virologist nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Sam Brown- Tubing on the Slopes Sat, 18 Jul 2009 02:36:13 -0800

Author: travelchannel
Added: Sat, 18 Jul 2009 02:36:13 -0800
Duration: 0

While at Keystone Mountain Resort in Colorado, Sam discovers she doesn't need skis to enjoy the slopes! New episodes of Samantha Brown's Great Weekends air Saturdays at 10PM only on Travel Channel. http://www.travelchannel.com/TV_Shows/Samantha_Brown

]]> brownchannelcoloradogreatkeystonemountainresortsamsamanthaseriesskisnowtraveltubevacationweekends http://revver.com/video/1798071/sam-brown-tubing-on-the-slopes/ http://revver.com/watch/1798071 Sam Brown- Tubing on the Slopes While at Keystone Mountain Resort in Colorado, Sam discovers she doesn't need skis to enjoy the slopes! New episodes of Samantha Brown's Great Weekends air Saturdays at 10PM only on Travel Channel. http://www.travelchannel.com/TV_Shows/Samantha_Brown While at Keystone Mountain Resort in Colorado, Sam discovers she doesn't need skis to enjoy the slopes! New episodes of Samantha Brown's Great Weekends air Saturdays at 10PM only on Travel Channel. http://www.travelchannel.com/TV_Shows/Samantha_Brown travelchannel travelchannel brown channel colorado great keystone mountain resort sam samantha series ski snow travel tube vacation weekends nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Ghost Adventures- Eerie Voices at the Moon River Brewery Fri, 17 Jul 2009 07:33:07 -0800

Author: travelchannel
Added: Fri, 17 Jul 2009 07:33:07 -0800
Duration: 0

In the cellar of the Moon River Brewery, Zak and Erin believe that a spirit may be drawing energy from their digital equipment in order to comminute with them. New episodes of Ghost Adventures air Fridays at 9PM only on Travel Channel! http://www.travelchannel.com/TV_Shows.

]]> adventuresbagansbrewerychanneleerieghostmoonnoiseriverseriessoundsspirittelevisiontravelvoiceswhitezak http://revver.com/video/1795811/ghost-adventures-eerie-voices-at-the-moon-river-brewery/ http://revver.com/watch/1795811 Ghost Adventures- Eerie Voices at the Moon River Brewery In the cellar of the Moon River Brewery, Zak and Erin believe that a spirit may be drawing energy from their digital equipment in order to comminute with them. New episodes of Ghost Adventures air Fridays at 9PM only on Travel Channel! http://www.travelchannel.com/TV_Shows. In the cellar of the Moon River Brewery, Zak and Erin believe that a spirit may be drawing energy from their digital equipment in order to comminute with them. New episodes of Ghost Adventures air Fridays at 9PM only on Travel Channel! http://www.travelchannel.com/TV_Shows. travelchannel travelchannel adventures bagans brewery channel eerie ghost moon noise river series sounds spirit television travel voices white zak nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bite Me with Dr. Mike- Dr. Mike Tours the Australian Outback Wed, 15 Jul 2009 10:50:20 -0800

Author: travelchannel
Added: Wed, 15 Jul 2009 10:50:20 -0800
Duration: 0

Dr. Mike tracks the trail of the world’s most venomous snake throughout the Australian outback. New episodes of Bite Me With Dr. Mike air Tuesday nights at 10PM, only on Travel Channel.

]]> australiabitedr mikeoutbacksnaketravel channelvenomvideo http://revver.com/video/1790513/bite-me-with-dr-mike-dr-mike-tours-the-australian-outback/ http://revver.com/watch/1790513 Bite Me with Dr. Mike- Dr. Mike Tours the Australian Outback Dr. Mike tracks the trail of the world’s most venomous snake throughout the Australian outback. New episodes of Bite Me With Dr. Mike air Tuesday nights at 10PM, only on Travel Channel. Dr. Mike tracks the trail of the world’s most venomous snake throughout the Australian outback. New episodes of Bite Me With Dr. Mike air Tuesday nights at 10PM, only on Travel Channel. travelchannel travelchannel australia bite dr mike outback snake travel channel venom video nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bite Me with Dr. Mike- Dr. Mike Tours the Australian Outback Wed, 15 Jul 2009 10:50:20 -0800

Author: travelchannel
Added: Wed, 15 Jul 2009 10:50:20 -0800
Duration: 0

Dr. Mike tracks the trail of the world’s most venomous snake throughout the Australian outback. New episodes of Bite Me With Dr. Mike air Tuesday nights at 10PM, only on Travel Channel.

]]> australiabitedr mikeoutbacksnaketravel channelvenomvideo http://revver.com/video/1790462/bite-me-with-dr-mike-dr-mike-tours-the-australian-outback/ http://revver.com/watch/1790462 Bite Me with Dr. Mike- Dr. Mike Tours the Australian Outback Dr. Mike tracks the trail of the world’s most venomous snake throughout the Australian outback. New episodes of Bite Me With Dr. Mike air Tuesday nights at 10PM, only on Travel Channel. Dr. Mike tracks the trail of the world’s most venomous snake throughout the Australian outback. New episodes of Bite Me With Dr. Mike air Tuesday nights at 10PM, only on Travel Channel. travelchannel travelchannel australia bite dr mike outback snake travel channel venom video nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Sam Brown - Sam Vs. Bull Sat, 11 Jul 2009 06:54:26 -0800

Author: travelchannel
Added: Sat, 11 Jul 2009 06:54:26 -0800
Duration: 0

While in Dallas, Texas, Sam gets a bull riding lesson from some old pros! New episodes of Samantha Brown's Great Weekends air Saturdays at 10PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Samantha_Brown

]]> brownbullchanneldallasgreatriderridingrodeosamsamanthaseriessouthwesttexastravelvacationweekends http://revver.com/video/1782899/sam-brown-sam-vs-bull/ http://revver.com/watch/1782899 Sam Brown - Sam Vs. Bull While in Dallas, Texas, Sam gets a bull riding lesson from some old pros! New episodes of Samantha Brown's Great Weekends air Saturdays at 10PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Samantha_Brown While in Dallas, Texas, Sam gets a bull riding lesson from some old pros! New episodes of Samantha Brown's Great Weekends air Saturdays at 10PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Samantha_Brown travelchannel travelchannel brown bull channel dallas great rider riding rodeo sam samantha series southwest texas travel vacation weekends nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Ghost Adventures - Phantom Footsteps in Eastern State Pen Wed, 08 Jul 2009 09:33:05 -0800

Author: travelchannel
Added: Wed, 08 Jul 2009 09:33:05 -0800
Duration: 0

Zak takes a trip along the catwalk of cellblock 12 in Eastern State Pen, where many claim the phantom footsteps of dead prisoners can still be heard. New episodes of Ghost Adventures air Fridays at 9PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Ghost_Adventures

]]> adventuresbaganschanneleasterneerieevpfootstepsghostnoisepenpennsylvaniaprisonseriessoundsstatetelevisiontravelwhitezak http://revver.com/video/1776713/ghost-adventures-phantom-footsteps-in-eastern-state-pen/ http://revver.com/watch/1776713 Ghost Adventures - Phantom Footsteps in Eastern State Pen Zak takes a trip along the catwalk of cellblock 12 in Eastern State Pen, where many claim the phantom footsteps of dead prisoners can still be heard. New episodes of Ghost Adventures air Fridays at 9PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Ghost_Adventures Zak takes a trip along the catwalk of cellblock 12 in Eastern State Pen, where many claim the phantom footsteps of dead prisoners can still be heard. New episodes of Ghost Adventures air Fridays at 9PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Ghost_Adventures travelchannel travelchannel adventures bagans channel eastern eerie evp footsteps ghost noise pen pennsylvania prison series sounds state television travel white zak nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Anthony Bourdain - Giant Hot Dogs from Chile Wed, 08 Jul 2009 09:33:05 -0800

Author: travelchannel
Added: Wed, 08 Jul 2009 09:33:05 -0800
Duration: 0

While in Chile, Tony stops by Sibaritico's to try a local favorite: foot-long hot dogs drenched in tomatoes, sauerkraut and guacamole in a mega bun! The new season of Anthony Bourdain: No Reservations premieres Monday, July 13th at 10PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Anthony_Bourdain

]]> anthonybourdainbunchannelchiledogfootgianthotlongnoreservationssibariticotravel http://revver.com/video/1776726/anthony-bourdain-giant-hot-dogs-from-chile/ http://revver.com/watch/1776726 Anthony Bourdain - Giant Hot Dogs from Chile While in Chile, Tony stops by Sibaritico's to try a local favorite: foot-long hot dogs drenched in tomatoes, sauerkraut and guacamole in a mega bun! The new season of Anthony Bourdain: No Reservations premieres Monday, July 13th at 10PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Anthony_Bourdain While in Chile, Tony stops by Sibaritico's to try a local favorite: foot-long hot dogs drenched in tomatoes, sauerkraut and guacamole in a mega bun! The new season of Anthony Bourdain: No Reservations premieres Monday, July 13th at 10PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Anthony_Bourdain travelchannel travelchannel anthony bourdain bun channel chile dog foot giant hot long no reservations sibaritico travel nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Sam Brown - The Santa Barbara Zoo Tue, 07 Jul 2009 13:52:40 -0800

Author: travelchannel
Added: Tue, 07 Jul 2009 13:52:40 -0800
Duration: 0

Sam takes a tour of the Santa Barbara Zoo, and meets a special guest lined up just for her -- a channel island fox! New episodes of Samantha Brown's Great Weekends air Saturdays at 10PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Samantha_Brown

]]> animalsbarbarabrowncaliforniachannelfoxgorillasgreatislandlifemonkeyssamsamanthasantaseriestravelvacationweekendswildzoo http://revver.com/video/1767428/sam-brown-the-santa-barbara-zoo/ http://revver.com/watch/1767428 Sam Brown - The Santa Barbara Zoo Sam takes a tour of the Santa Barbara Zoo, and meets a special guest lined up just for her -- a channel island fox! New episodes of Samantha Brown's Great Weekends air Saturdays at 10PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Samantha_Brown Sam takes a tour of the Santa Barbara Zoo, and meets a special guest lined up just for her -- a channel island fox! New episodes of Samantha Brown's Great Weekends air Saturdays at 10PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Samantha_Brown travelchannel travelchannel animals barbara brown california channel fox gorillas great island life monkeys sam samantha santa series travel vacation weekends wild zoo nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bite Me With Dr. Mike - Tunnels Under Vietnam Tue, 07 Jul 2009 13:52:40 -0800

Author: travelchannel
Added: Tue, 07 Jul 2009 13:52:40 -0800
Duration: 0

Dr. Mike explores claustrophobic tunnels under Vietnam that were built to protect soldiers and civilians during times of war. New episodes of Bite Me With Dr. Mike air Tuesday nights at 10PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Bite_Me_with_Dr_Mike

]]> bitechannelclaustrophobicdoctordrmemikesoldierstelevisiontraveltunnelstvvietnamvirologistwar http://revver.com/video/1773888/bite-me-with-dr-mike-tunnels-under-vietnam/ http://revver.com/watch/1773888 Bite Me With Dr. Mike - Tunnels Under Vietnam Dr. Mike explores claustrophobic tunnels under Vietnam that were built to protect soldiers and civilians during times of war. New episodes of Bite Me With Dr. Mike air Tuesday nights at 10PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Bite_Me_with_Dr_Mike Dr. Mike explores claustrophobic tunnels under Vietnam that were built to protect soldiers and civilians during times of war. New episodes of Bite Me With Dr. Mike air Tuesday nights at 10PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Bite_Me_with_Dr_Mike travelchannel travelchannel bite channel claustrophobic doctor dr me mike soldiers television travel tunnels tv vietnam virologist war nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Ghost Adventures - Entering the Bird Cage Theater Thu, 02 Jul 2009 16:34:07 -0800

Author: travelchannel
Added: Thu, 02 Jul 2009 16:34:07 -0800
Duration: 0

Zak takes his team into The Bird Cage Theater in Tombstone Arizona, where they encounter mysterious voices and sweeping drafts of spiritual energy. New episodes of Ghost Adventures air Fridays at 9PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Ghost_Adventures

]]> adventuresantiquesarizonaazbagansbirdbirdcagecagechannelchillscivileerieevpghostghostsmannequinsnoiseseriessoundssouthspiritstelevisiontheatertombstonetravelwarwestwhitewildzak http://revver.com/video/1765336/ghost-adventures-entering-the-bird-cage-theater/ http://revver.com/watch/1765336 Ghost Adventures - Entering the Bird Cage Theater Zak takes his team into The Bird Cage Theater in Tombstone Arizona, where they encounter mysterious voices and sweeping drafts of spiritual energy. New episodes of Ghost Adventures air Fridays at 9PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Ghost_Adventures Zak takes his team into The Bird Cage Theater in Tombstone Arizona, where they encounter mysterious voices and sweeping drafts of spiritual energy. New episodes of Ghost Adventures air Fridays at 9PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Ghost_Adventures travelchannel travelchannel adventures antiques arizona az bagans bird birdcage cage channel chills civil eerie evp ghost ghosts mannequins noise series sounds south spirits television theater tombstone travel war west white wild zak nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Travel Channel's Getaway Sweeps - Santiago, Chile Thu, 02 Jul 2009 16:34:07 -0800

Author: travelchannel
Added: Thu, 02 Jul 2009 16:34:07 -0800
Duration: 0

Enter Travel Channel's Travel Bug Getaway Sweepstakes, and win a round-trip vacation to Santiago, Chile! You and a guest will stay 7 nights in a 4-star hotel and enjoy trips to wineries and a wine-tasting class where you'll discover the wonderful wines of Chile. Enter here for your chance to win : http://win.travelchannel.com

]]> anthonybourdainbugchannelchilesantiagosweepstakestastingtraveltripvacationvineyardswinewineries http://revver.com/video/1765340/travel-channels-getaway-sweeps-santiago-chile/ http://revver.com/watch/1765340 Travel Channel's Getaway Sweeps - Santiago, Chile Enter Travel Channel's Travel Bug Getaway Sweepstakes, and win a round-trip vacation to Santiago, Chile! You and a guest will stay 7 nights in a 4-star hotel and enjoy trips to wineries and a wine-tasting class where you'll discover the wonderful wines of Chile. Enter here for your chance to win : http://win.travelchannel.com Enter Travel Channel's Travel Bug Getaway Sweepstakes, and win a round-trip vacation to Santiago, Chile! You and a guest will stay 7 nights in a 4-star hotel and enjoy trips to wineries and a wine-tasting class where you'll discover the wonderful wines of Chile. Enter here for your chance to win : http://win.travelchannel.com travelchannel travelchannel anthony bourdain bug channel chile santiago sweepstakes tasting travel trip vacation vineyards wine wineries nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bite Me With Dr. Mike - Bathing in the Ganges River Wed, 01 Jul 2009 07:32:55 -0800

Author: travelchannel
Added: Wed, 01 Jul 2009 07:32:55 -0800
Duration: 0

Dr. Mike confronts his fear and takes a dip in the Ganges. It's one of India's major rivers, and is used as a ritual bathing place, a laundry, bathroom and sewer. New episodes of Bite Me With Dr. Mike air Tuesday nights at 10PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Bite_Me_with_Dr_Mike

]]> bacteriabathbathingbitechanneldoctordrgangesgermshazardindiamemikeritualriversewertelevisiontraveltvvirologist http://revver.com/video/1760612/bite-me-with-dr-mike-bathing-in-the-ganges-river/ http://revver.com/watch/1760612 Bite Me With Dr. Mike - Bathing in the Ganges River Dr. Mike confronts his fear and takes a dip in the Ganges. It's one of India's major rivers, and is used as a ritual bathing place, a laundry, bathroom and sewer. New episodes of Bite Me With Dr. Mike air Tuesday nights at 10PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Bite_Me_with_Dr_Mike Dr. Mike confronts his fear and takes a dip in the Ganges. It's one of India's major rivers, and is used as a ritual bathing place, a laundry, bathroom and sewer. New episodes of Bite Me With Dr. Mike air Tuesday nights at 10PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Bite_Me_with_Dr_Mike travelchannel travelchannel bacteria bath bathing bite channel doctor dr ganges germs hazard india me mike ritual river sewer television travel tv virologist nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Ghost Adventures - Magnolia Plantation Promo Thu, 25 Jun 2009 09:52:55 -0800

Author: travelchannel
Added: Thu, 25 Jun 2009 09:52:55 -0800
Duration: 0

Zak Bagans and his team visit the grounds of the Magnolia Plantation in Louisiana to uncover the historic site's haunted past. New episodes of Ghost Adventures air Fridays at 9PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Ghost_Adventures

]]> adventuresalterbaganschannelchapelchurcheerieevpghostlamissionnoisepurisimaseriessoundstelevisiontravelwhitezak http://revver.com/video/1751675/ghost-adventures-magnolia-plantation-promo/ http://revver.com/watch/1751675 Ghost Adventures - Magnolia Plantation Promo Zak Bagans and his team visit the grounds of the Magnolia Plantation in Louisiana to uncover the historic site's haunted past. New episodes of Ghost Adventures air Fridays at 9PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Ghost_Adventures Zak Bagans and his team visit the grounds of the Magnolia Plantation in Louisiana to uncover the historic site's haunted past. New episodes of Ghost Adventures air Fridays at 9PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Ghost_Adventures travelchannel travelchannel adventures alter bagans channel chapel church eerie evp ghost la mission noise purisima series sounds television travel white zak nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Samantha Brown - Snorkeling in Maui Sat, 20 Jun 2009 05:52:58 -0800

Author: travelchannel
Added: Sat, 20 Jun 2009 05:52:58 -0800
Duration: 0

Sam journeys beneath the warm waters of Maui, and takes photos of the unusual and exotic marine life below. New episodes of Samantha Brown's Great Weekends air Saturdays at 10PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Samantha_Brown

]]> beachbrownchannelexoticfishgreathawaiiislandlifemarinemauioceanpacificsamsamanthaseaseriessnorkelsnorkelingtraveltropicalundervacationwaterweekends http://revver.com/video/1739385/samantha-brown-snorkeling-in-maui/ http://revver.com/watch/1739385 Samantha Brown - Snorkeling in Maui Sam journeys beneath the warm waters of Maui, and takes photos of the unusual and exotic marine life below. New episodes of Samantha Brown's Great Weekends air Saturdays at 10PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Samantha_Brown Sam journeys beneath the warm waters of Maui, and takes photos of the unusual and exotic marine life below. New episodes of Samantha Brown's Great Weekends air Saturdays at 10PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Samantha_Brown travelchannel travelchannel beach brown channel exotic fish great hawaii island life marine maui ocean pacific sam samantha sea series snorkel snorkeling travel tropical under vacation water weekends nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bite Me With Dr. Mike - Brazilian Fire Ants Thu, 18 Jun 2009 05:32:54 -0800

Author: travelchannel
Added: Thu, 18 Jun 2009 05:32:54 -0800
Duration: 0

Virologist and adventure junkie Dr. Mike Leahy subjects himself to the venomous, burning bite of the brazilian fire ant. Bite Me With Dr. Mike premieres Tuesday, June 23rd at 10PM on the Travel Channel. http://www.travelchannel.com/TV_Shows/Bite_Me_with_Dr_Mike

]]> antantsbitebrazilianburningchanneldoctordrfireitchingmemikepoisonstingtelevisiontraveltvvirologist http://revver.com/video/1736371/bite-me-with-dr-mike-brazilian-fire-ants/ http://revver.com/watch/1736371 Bite Me With Dr. Mike - Brazilian Fire Ants Virologist and adventure junkie Dr. Mike Leahy subjects himself to the venomous, burning bite of the brazilian fire ant. Bite Me With Dr. Mike premieres Tuesday, June 23rd at 10PM on the Travel Channel. http://www.travelchannel.com/TV_Shows/Bite_Me_with_Dr_Mike Virologist and adventure junkie Dr. Mike Leahy subjects himself to the venomous, burning bite of the brazilian fire ant. Bite Me With Dr. Mike premieres Tuesday, June 23rd at 10PM on the Travel Channel. http://www.travelchannel.com/TV_Shows/Bite_Me_with_Dr_Mike travelchannel travelchannel ant ants bite brazilian burning channel doctor dr fire itching me mike poison sting television travel tv virologist nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Ghost Adventures - Haunted Voice in La Purisima Mission Tue, 16 Jun 2009 13:03:27 -0800

Author: travelchannel
Added: Tue, 16 Jun 2009 13:03:27 -0800
Duration: 0

Zak Bagans and his team capture a spirit's voice on tape while exploring the haunted jail cell of La Purisima Mission. New episodes of Ghost Adventures air Fridays at 9PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Ghost_Adventures

]]> adventuresalterbaganschannelchapelchurcheerieevpghostlamissionnoisepurisimaseriessoundstelevisiontravelwhitezak http://revver.com/video/1731971/ghost-adventures-haunted-voice-in-la-purisima-mission/ http://revver.com/watch/1731971 Ghost Adventures - Haunted Voice in La Purisima Mission Zak Bagans and his team capture a spirit's voice on tape while exploring the haunted jail cell of La Purisima Mission. New episodes of Ghost Adventures air Fridays at 9PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Ghost_Adventures Zak Bagans and his team capture a spirit's voice on tape while exploring the haunted jail cell of La Purisima Mission. New episodes of Ghost Adventures air Fridays at 9PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Ghost_Adventures travelchannel travelchannel adventures alter bagans channel chapel church eerie evp ghost la mission noise purisima series sounds television travel white zak nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bizarre Foods Survival Special Thu, 11 Jun 2009 07:52:49 -0800

Author: travelchannel
Added: Thu, 11 Jun 2009 07:52:49 -0800
Duration: 0

Andrew is taught survival techniques that help him track down two sources of protein in the forest: a baby lizard and bug larva. The Bizarre Food Survival Special airs Tuesday, June 16th at 10PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Bizarre_Foods

]]> andrewbizarrebugschannelcitruseggsfoodshawkjunglelarvalizardlostproteinspecialsurvivaltraveltreeswaterwildwildernesszimmern http://revver.com/video/1721428/bizarre-foods-survival-special/ http://revver.com/watch/1721428 Bizarre Foods Survival Special Andrew is taught survival techniques that help him track down two sources of protein in the forest: a baby lizard and bug larva. The Bizarre Food Survival Special airs Tuesday, June 16th at 10PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Bizarre_Foods Andrew is taught survival techniques that help him track down two sources of protein in the forest: a baby lizard and bug larva. The Bizarre Food Survival Special airs Tuesday, June 16th at 10PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Bizarre_Foods travelchannel travelchannel andrew bizarre bugs channel citrus eggs foods hawk jungle larva lizard lost protein special survival travel trees water wild wilderness zimmern nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Ghost Adventures - Soldier's Quarters in Castillo de San Marcos Tue, 09 Jun 2009 07:49:45 -0800

Author: travelchannel
Added: Tue, 09 Jun 2009 07:49:45 -0800
Duration: 0

Ghost hunter Zak Bagans and his team investigate the soldier's quarters of Castillo de San Marcos, where one caretaker claims to have heard the sound of boot steps. New episodes of Ghost Adventures begin Friday June 5th at 9PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Ghost_Adventures

]]> adventuresbagansbattlebootsbunkscastillochanneldeeerieevpghostmarcosnoiseprisonersquarterssanseriessoldierssoundstelevisiontraveltreasurewarwhitezak http://revver.com/video/1716910/ghost-adventures-soldiers-quarters-in-castillo-de-san-marcos/ http://revver.com/watch/1716910 Ghost Adventures - Soldier's Quarters in Castillo de San Marcos Ghost hunter Zak Bagans and his team investigate the soldier's quarters of Castillo de San Marcos, where one caretaker claims to have heard the sound of boot steps. New episodes of Ghost Adventures begin Friday June 5th at 9PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Ghost_Adventures Ghost hunter Zak Bagans and his team investigate the soldier's quarters of Castillo de San Marcos, where one caretaker claims to have heard the sound of boot steps. New episodes of Ghost Adventures begin Friday June 5th at 9PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Ghost_Adventures travelchannel travelchannel adventures bagans battle boots bunks castillo channel de eerie evp ghost marcos noise prisoners quarters san series soldiers sounds television travel treasure war white zak nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bizarre Foods - Guinea Fowl in Puerto Rico Sat, 06 Jun 2009 11:52:49 -0800

Author: travelchannel
Added: Sat, 06 Jun 2009 11:52:49 -0800
Duration: 0

Andrew visits Puerto Rico, where he is served a hearty, home-grown meal including guinea fowl and pork. Bizarre Foods airs Tuesday nights at 10pm e/p on Travel Channel http://www.travelchannel.com/TV_Shows/Bizarre_Foods

]]> andrewbizarrebloodchannelchickenfoodsfowlgrownguineahomelatinnaturalpigsporkpuertoricotravelzimmern http://revver.com/video/1709508/bizarre-foods-guinea-fowl-in-puerto-rico/ http://revver.com/watch/1709508 Bizarre Foods - Guinea Fowl in Puerto Rico Andrew visits Puerto Rico, where he is served a hearty, home-grown meal including guinea fowl and pork. Bizarre Foods airs Tuesday nights at 10pm e/p on Travel Channel http://www.travelchannel.com/TV_Shows/Bizarre_Foods Andrew visits Puerto Rico, where he is served a hearty, home-grown meal including guinea fowl and pork. Bizarre Foods airs Tuesday nights at 10pm e/p on Travel Channel http://www.travelchannel.com/TV_Shows/Bizarre_Foods travelchannel travelchannel andrew bizarre blood channel chicken foods fowl grown guinea home latin natural pigs pork puerto rico travel zimmern nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Samantha Brown - Sausage Challenge in Boston Sat, 06 Jun 2009 09:52:34 -0800

Author: travelchannel
Added: Sat, 06 Jun 2009 09:52:34 -0800
Duration: 0

Samantha Brown visits Boston, where she competes in the World Championship Italian Sausage Eating Contest. New episodes of Samantha Brown's Great Weekends air Saturdays at 10PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Samantha_Brown

]]> bostonbrownchampionshipchannelcontesteatfoodgreatitalianmassachusettssamsamanthasausageseriestravelvacationweekends http://revver.com/video/1708806/samantha-brown-sausage-challenge-in-boston/ http://revver.com/watch/1708806 Samantha Brown - Sausage Challenge in Boston Samantha Brown visits Boston, where she competes in the World Championship Italian Sausage Eating Contest. New episodes of Samantha Brown's Great Weekends air Saturdays at 10PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Samantha_Brown Samantha Brown visits Boston, where she competes in the World Championship Italian Sausage Eating Contest. New episodes of Samantha Brown's Great Weekends air Saturdays at 10PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Samantha_Brown travelchannel travelchannel boston brown championship channel contest eat food great italian massachusetts sam samantha sausage series travel vacation weekends nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Ghost Adventures - Preston Castle Sat, 30 May 2009 08:33:58 -0800

Author: travelchannel
Added: Sat, 30 May 2009 08:33:58 -0800
Duration: 0

Ghost hunter Zak Bagans is given a tour of Preston Castle's infirmary, where paranormal activity runs rampant in the abandoned building. New episodes of Ghost Adventures begin Friday June 5th at 9PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Ghost_Adventures

]]> abandonedadventuresbagansbuildingchanneldeaddoctorsdyingeerieevpghostmansionnoisenursespatientsprestonseriessoundstelevisiontravelwhitezak http://revver.com/video/1696182/ghost-adventures-preston-castle/ http://revver.com/watch/1696182 Ghost Adventures - Preston Castle Ghost hunter Zak Bagans is given a tour of Preston Castle's infirmary, where paranormal activity runs rampant in the abandoned building. New episodes of Ghost Adventures begin Friday June 5th at 9PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Ghost_Adventures Ghost hunter Zak Bagans is given a tour of Preston Castle's infirmary, where paranormal activity runs rampant in the abandoned building. New episodes of Ghost Adventures begin Friday June 5th at 9PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Ghost_Adventures travelchannel travelchannel abandoned adventures bagans building channel dead doctors dying eerie evp ghost mansion noise nurses patients preston series sounds television travel white zak nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bizarre Foods - 'Food of the Pig' in Nicaragua Sat, 30 May 2009 07:52:33 -0800

Author: travelchannel
Added: Sat, 30 May 2009 07:52:33 -0800
Duration: 0

While traveling through Nicaragua, Andrew stops by a late-night food stand and tries a local delicacy known as 'food of the pig.' Bizarre Foods airs Tuesday nights at 10pm e/p on Travel Channel http://www.travelchannel.com/TV_Shows/Bizarre_Foods

]]> andrewbizarrebloodchannelfoodfoodslatenicaraguanightpigsausagesnackstandtonguetravelzimmern http://revver.com/video/1694480/bizarre-foods-food-of-the-pig-in-nicaragua/ http://revver.com/watch/1694480 Bizarre Foods - 'Food of the Pig' in Nicaragua While traveling through Nicaragua, Andrew stops by a late-night food stand and tries a local delicacy known as 'food of the pig.' Bizarre Foods airs Tuesday nights at 10pm e/p on Travel Channel http://www.travelchannel.com/TV_Shows/Bizarre_Foods While traveling through Nicaragua, Andrew stops by a late-night food stand and tries a local delicacy known as 'food of the pig.' Bizarre Foods airs Tuesday nights at 10pm e/p on Travel Channel http://www.travelchannel.com/TV_Shows/Bizarre_Foods travelchannel travelchannel andrew bizarre blood channel food foods late nicaragua night pig sausage snack stand tongue travel zimmern nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Ghost Adventures - Bad Stuff Thu, 28 May 2009 20:33:21 -0800

Author: travelchannel
Added: Thu, 28 May 2009 20:33:21 -0800
Duration: 0

An eerie voice is captured saying "bad stuff'' on an EVP recording device. New episodes of Ghost Adventures begin Friday June 5th at 9PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Ghost_Adventures

]]> adventureschanneleerieevpghostnoiseseriessoundstelevisiontravelwhite http://revver.com/video/1687676/ghost-adventures-bad-stuff/ http://revver.com/watch/1687676 Ghost Adventures - Bad Stuff An eerie voice is captured saying "bad stuff'' on an EVP recording device. New episodes of Ghost Adventures begin Friday June 5th at 9PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Ghost_Adventures An eerie voice is captured saying "bad stuff'' on an EVP recording device. New episodes of Ghost Adventures begin Friday June 5th at 9PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Ghost_Adventures travelchannel travelchannel adventures channel eerie evp ghost noise series sounds television travel white nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Ghost Adventures - Be Careful Thu, 28 May 2009 20:33:21 -0800

Author: travelchannel
Added: Thu, 28 May 2009 20:33:21 -0800
Duration: 0

An eerie voice is captured saying "be careful'' on an EVP recording device. New episodes of Ghost Adventures begin Friday June 5th at 9PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Ghost_Adventures

]]> adventureschanneleerieevpghostnoiseseriessoundstelevisiontravelwhite http://revver.com/video/1687680/ghost-adventures-be-careful/ http://revver.com/watch/1687680 Ghost Adventures - Be Careful An eerie voice is captured saying "be careful'' on an EVP recording device. New episodes of Ghost Adventures begin Friday June 5th at 9PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Ghost_Adventures An eerie voice is captured saying "be careful'' on an EVP recording device. New episodes of Ghost Adventures begin Friday June 5th at 9PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Ghost_Adventures travelchannel travelchannel adventures channel eerie evp ghost noise series sounds television travel white nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Ghost Adventures - They're Coming Thu, 28 May 2009 20:33:21 -0800

Author: travelchannel
Added: Thu, 28 May 2009 20:33:21 -0800
Duration: 0

An eerie voice is captured saying "they're coming'' on an EVP recording device. New episodes of Ghost Adventures begin Friday June 5th at 9PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Ghost_Adventures

]]> adventureschanneleerieevpghostnoiseseriessoundstelevisiontravelwhite http://revver.com/video/1687699/ghost-adventures-theyre-coming/ http://revver.com/watch/1687699 Ghost Adventures - They're Coming An eerie voice is captured saying "they're coming'' on an EVP recording device. New episodes of Ghost Adventures begin Friday June 5th at 9PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Ghost_Adventures An eerie voice is captured saying "they're coming'' on an EVP recording device. New episodes of Ghost Adventures begin Friday June 5th at 9PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Ghost_Adventures travelchannel travelchannel adventures channel eerie evp ghost noise series sounds television travel white nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bizarre Foods - Rattlesnake Sausage Mon, 25 May 2009 14:52:34 -0800

Author: travelchannel
Added: Mon, 25 May 2009 14:52:34 -0800
Duration: 0

Andrew travels to the Lonesome Dove Western Bistro in Texas, where dines on rabbit and rattlesnake sausage. Bizarre Foods airs Tuesday nights at 10pm e/p on Travel Channel http://www.travelchannel.com/TV_Shows/Bizarre_Foods

]]> andrewbizarrechanneldeerfoodslocalloneproteinrabbitrattlesnakesausagesouthsoutherstarstatetexastravelwesternzimmern http://revver.com/video/1678475/bizarre-foods-rattlesnake-sausage/ http://revver.com/watch/1678475 Bizarre Foods - Rattlesnake Sausage Andrew travels to the Lonesome Dove Western Bistro in Texas, where dines on rabbit and rattlesnake sausage. Bizarre Foods airs Tuesday nights at 10pm e/p on Travel Channel http://www.travelchannel.com/TV_Shows/Bizarre_Foods Andrew travels to the Lonesome Dove Western Bistro in Texas, where dines on rabbit and rattlesnake sausage. Bizarre Foods airs Tuesday nights at 10pm e/p on Travel Channel http://www.travelchannel.com/TV_Shows/Bizarre_Foods travelchannel travelchannel andrew bizarre channel deer foods local lone protein rabbit rattlesnake sausage south souther star state texas travel western zimmern nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Samantha Brown - Hawaii Promo Mon, 25 May 2009 13:32:54 -0800

Author: travelchannel
Added: Mon, 25 May 2009 13:32:54 -0800
Duration: 0

Sam Brown returns to the tropical paradise of Hawaii, where she takes a lesson in conch blowing, and explores erupting volcanoes for a far. Don't miss it Saturday, May 23rd at 10PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Samantha_Brown

]]> blowingbrownchannelchiefconchgreathawaiipacificparadisesamsamanthaseaseriesshelltraveltropicalvacationvolcanoesweekends http://revver.com/video/1675783/samantha-brown-hawaii-promo/ http://revver.com/watch/1675783 Samantha Brown - Hawaii Promo Sam Brown returns to the tropical paradise of Hawaii, where she takes a lesson in conch blowing, and explores erupting volcanoes for a far. Don't miss it Saturday, May 23rd at 10PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Samantha_Brown Sam Brown returns to the tropical paradise of Hawaii, where she takes a lesson in conch blowing, and explores erupting volcanoes for a far. Don't miss it Saturday, May 23rd at 10PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Samantha_Brown travelchannel travelchannel blowing brown channel chief conch great hawaii pacific paradise sam samantha sea series shell travel tropical vacation volcanoes weekends nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bizarre Foods - Sup Tulang in Singapore Wed, 20 May 2009 09:33:05 -0800

Author: travelchannel
Added: Wed, 20 May 2009 09:33:05 -0800
Duration: 0

Andre travels to the Singapore, where he dines on sup tulang -- mutton bones stewed in a sweet & spicy chili sauce. Bizarre Foods airs Tuesday nights at 10pm e/p on Travel Channel http://www.travelchannel.com/TV_Shows/Bizarre_Foods

]]> andrewasiaasianbizarrechannelchilicuisinefoodsmuttonsaucesingaporesuptraveltunlangzimmern http://revver.com/video/1667199/bizarre-foods-sup-tulang-in-singapore/ http://revver.com/watch/1667199 Bizarre Foods - Sup Tulang in Singapore Andre travels to the Singapore, where he dines on sup tulang -- mutton bones stewed in a sweet & spicy chili sauce. Bizarre Foods airs Tuesday nights at 10pm e/p on Travel Channel http://www.travelchannel.com/TV_Shows/Bizarre_Foods Andre travels to the Singapore, where he dines on sup tulang -- mutton bones stewed in a sweet & spicy chili sauce. Bizarre Foods airs Tuesday nights at 10pm e/p on Travel Channel http://www.travelchannel.com/TV_Shows/Bizarre_Foods travelchannel travelchannel andrew asia asian bizarre channel chili cuisine foods mutton sauce singapore sup travel tunlang zimmern nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Samantha Brown's Great Weekends - Scared Stiff In Charleston Sat, 16 May 2009 21:54:22 -0800

Author: travelchannel
Added: Sat, 16 May 2009 21:54:22 -0800
Duration: 0

Samantha takes a spooky tour through the haunted city jail of Charleston, South Carolina. New episodes of Samantha Brown's Great Weekends air Saturday nights at 10PM e/p only on the Travel Channel. http://www.travelchannel.com/TV_Shows/Samantha_Brown

]]> browncarolinachannelcharlestoncityghostsgreathauntedjailsamsamanthaseriessouthsouthernspookytourtravelvacationweekends http://revver.com/video/1655449/samantha-browns-great-weekends-scared-stiff-in-charleston/ http://revver.com/watch/1655449 Samantha Brown's Great Weekends - Scared Stiff In Charleston Samantha takes a spooky tour through the haunted city jail of Charleston, South Carolina. New episodes of Samantha Brown's Great Weekends air Saturday nights at 10PM e/p only on the Travel Channel. http://www.travelchannel.com/TV_Shows/Samantha_Brown Samantha takes a spooky tour through the haunted city jail of Charleston, South Carolina. New episodes of Samantha Brown's Great Weekends air Saturday nights at 10PM e/p only on the Travel Channel. http://www.travelchannel.com/TV_Shows/Samantha_Brown travelchannel travelchannel brown carolina channel charleston city ghosts great haunted jail sam samantha series south southern spooky tour travel vacation weekends nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bizarre Foods - Rockpool In Sydney, Australia Wed, 13 May 2009 10:32:55 -0800

Author: travelchannel
Added: Wed, 13 May 2009 10:32:55 -0800
Duration: 0

Andrew travels to Rockpool in Sydney where samples a dish known to locals as 'fish in firewater.' Bizarre Foods airs Tuesday nights at 10pm e/p on Travel Channel http://www.travelchannel.com/TV_Shows/Bizarre_Foods

]]> andrewaustraliabizarrechannelfirewaterfishfoodspoolrockrockpoolrockssydneytravelzimmern http://revver.com/video/1650745/bizarre-foods-rockpool-in-sydney-australia/ http://revver.com/watch/1650745 Bizarre Foods - Rockpool In Sydney, Australia Andrew travels to Rockpool in Sydney where samples a dish known to locals as 'fish in firewater.' Bizarre Foods airs Tuesday nights at 10pm e/p on Travel Channel http://www.travelchannel.com/TV_Shows/Bizarre_Foods Andrew travels to Rockpool in Sydney where samples a dish known to locals as 'fish in firewater.' Bizarre Foods airs Tuesday nights at 10pm e/p on Travel Channel http://www.travelchannel.com/TV_Shows/Bizarre_Foods travelchannel travelchannel andrew australia bizarre channel firewater fish foods pool rock rockpool rocks sydney travel zimmern nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Samantha Brown's Great Weekends - Minnesota Tue, 12 May 2009 07:52:42 -0800

Author: travelchannel
Added: Tue, 12 May 2009 07:52:42 -0800
Duration: 0

Sam bundles up and takes a trip to northern Minnesota where she tries her hand at dog sledding in the frigid wilderness. A brand-new season of Samantha Brown's Great Weekends premieres Saturday, May 9th at 10PM e/p on Travel Channel. http://www.travelchannel.com/TV_Shows/Samantha_Brown

]]> awaybrownchannelcolddogfreezinggetgreatminnesotanorthnorthernsamsamanthaseriessleddingtravelvacationweekendswilderness http://revver.com/video/1644751/samantha-browns-great-weekends-minnesota/ http://revver.com/watch/1644751 Samantha Brown's Great Weekends - Minnesota Sam bundles up and takes a trip to northern Minnesota where she tries her hand at dog sledding in the frigid wilderness. A brand-new season of Samantha Brown's Great Weekends premieres Saturday, May 9th at 10PM e/p on Travel Channel. http://www.travelchannel.com/TV_Shows/Samantha_Brown Sam bundles up and takes a trip to northern Minnesota where she tries her hand at dog sledding in the frigid wilderness. A brand-new season of Samantha Brown's Great Weekends premieres Saturday, May 9th at 10PM e/p on Travel Channel. http://www.travelchannel.com/TV_Shows/Samantha_Brown travelchannel travelchannel away brown channel cold dog freezing get great minnesota north northern sam samantha series sledding travel vacation weekends wilderness nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bizarre Foods - Squirrel Brains Wed, 06 May 2009 13:53:49 -0800

Author: travelchannel
Added: Wed, 06 May 2009 13:53:49 -0800
Duration: 0

Andrew visits The Snowshoe Mountain Resort in Appalachia, where he dines on traditional mountain comfort food -- squirrel brains. Bizarre Foods airs Tuesday nights at 10pm e/p on Travel Channel http://www.travelchannel.com/TV_Shows/Bizarre_Foods

]]> andrewappalachiabizarrebrainschannelcomfortfoodslodgemountainsresortsnowshoesquirreltravel http://revver.com/video/1637157/bizarre-foods-squirrel-brains/ http://revver.com/watch/1637157 Bizarre Foods - Squirrel Brains Andrew visits The Snowshoe Mountain Resort in Appalachia, where he dines on traditional mountain comfort food -- squirrel brains. Bizarre Foods airs Tuesday nights at 10pm e/p on Travel Channel http://www.travelchannel.com/TV_Shows/Bizarre_Foods Andrew visits The Snowshoe Mountain Resort in Appalachia, where he dines on traditional mountain comfort food -- squirrel brains. Bizarre Foods airs Tuesday nights at 10pm e/p on Travel Channel http://www.travelchannel.com/TV_Shows/Bizarre_Foods travelchannel travelchannel andrew appalachia bizarre brains channel comfort foods lodge mountains resort snowshoe squirrel travel nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bizarre Foods - Eating Raw Croc Eggs Sun, 26 Apr 2009 17:52:43 -0800

Author: travelchannel
Added: Sun, 26 Apr 2009 17:52:43 -0800
Duration: 0

Andrew meets a few Aborigines from the Nauiyu Nambiyu community, where he proves that he's not a "sheila" and tries raw crocodile eggs. Bizarre Foods airs Tuesday nights at 10pm e/p on Travel Channel http://www.travelchannel.com/TV_Shows/Bizarre_Foods

]]> aboriginesandrewaustraliabizarrechannelcrocodileeggsfoodsnambiyunauiyuoutbacktraveltribe http://revver.com/video/1615837/bizarre-foods-eating-raw-croc-eggs/ http://revver.com/watch/1615837 Bizarre Foods - Eating Raw Croc Eggs Andrew meets a few Aborigines from the Nauiyu Nambiyu community, where he proves that he's not a "sheila" and tries raw crocodile eggs. Bizarre Foods airs Tuesday nights at 10pm e/p on Travel Channel http://www.travelchannel.com/TV_Shows/Bizarre_Foods Andrew meets a few Aborigines from the Nauiyu Nambiyu community, where he proves that he's not a "sheila" and tries raw crocodile eggs. Bizarre Foods airs Tuesday nights at 10pm e/p on Travel Channel http://www.travelchannel.com/TV_Shows/Bizarre_Foods travelchannel travelchannel aborigines andrew australia bizarre channel crocodile eggs foods nambiyu nauiyu outback travel tribe nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bizarre Foods - Live Soup In South Korea Sat, 18 Apr 2009 14:32:52 -0800

Author: travelchannel
Added: Sat, 18 Apr 2009 14:32:52 -0800
Duration: 0

Andrew journeys to South Korea, where he samples soup filled with ginger, chilis, and mud fish that are cooked alive at the diner's table. Tune in Tuesdays at 10 E/P on Travel Channel! http://www.travelchannel.com/bizarre

]]> aliveandrewasiabizarrechannelculturefishfoodskorealivingmudshocksouptravelzimmern http://revver.com/video/1600768/bizarre-foods-live-soup-in-south-korea/ http://revver.com/watch/1600768 Bizarre Foods - Live Soup In South Korea Andrew journeys to South Korea, where he samples soup filled with ginger, chilis, and mud fish that are cooked alive at the diner's table. Tune in Tuesdays at 10 E/P on Travel Channel! http://www.travelchannel.com/bizarre Andrew journeys to South Korea, where he samples soup filled with ginger, chilis, and mud fish that are cooked alive at the diner's table. Tune in Tuesdays at 10 E/P on Travel Channel! http://www.travelchannel.com/bizarre travelchannel travelchannel alive andrew asia bizarre channel culture fish foods korea living mud shock soup travel zimmern nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bridget's Sexiest Beaches - Barcelona, Spain Thu, 16 Apr 2009 16:42:53 -0800

Author: travelchannel
Added: Thu, 16 Apr 2009 16:42:53 -0800
Duration: 0

Bridget hops on a scooter for a guided tour through the streets of Barcelona, Spain. Bridget's Sexiest Beaches airs Thursdays at 10pm E/P on Travel Channel. travelchannel.com/bridget

]]> barcelonabeachesbridgetlatinmarquardtplayboyplaymatescootersexiestspaintour http://revver.com/video/1596540/bridgets-sexiest-beaches-barcelona-spain/ http://revver.com/watch/1596540 Bridget's Sexiest Beaches - Barcelona, Spain Bridget hops on a scooter for a guided tour through the streets of Barcelona, Spain. Bridget's Sexiest Beaches airs Thursdays at 10pm E/P on Travel Channel. travelchannel.com/bridget Bridget hops on a scooter for a guided tour through the streets of Barcelona, Spain. Bridget's Sexiest Beaches airs Thursdays at 10pm E/P on Travel Channel. travelchannel.com/bridget travelchannel travelchannel barcelona beaches bridget latin marquardt playboy playmate scooter sexiest spain tour nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Dhani Tackles The Globe - Jai Alai in Spain Tue, 14 Apr 2009 11:48:38 -0800

Author: travelchannel
Added: Tue, 14 Apr 2009 11:48:38 -0800
Duration: 0

Dhani travels to Spain where he learns the sport of Jai Alai with two of the country's finest players. Dhani Tackles The Globe airs Monday nights at 9PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Dhani_Jones

]]> alaichanneldhanifootballjaijonesnflproprofessionalspaintravel http://revver.com/video/1591918/dhani-tackles-the-globe-jai-alai-in-spain/ http://revver.com/watch/1591918 Dhani Tackles The Globe - Jai Alai in Spain Dhani travels to Spain where he learns the sport of Jai Alai with two of the country's finest players. Dhani Tackles The Globe airs Monday nights at 9PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Dhani_Jones Dhani travels to Spain where he learns the sport of Jai Alai with two of the country's finest players. Dhani Tackles The Globe airs Monday nights at 9PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Dhani_Jones travelchannel travelchannel alai channel dhani football jai jones nfl pro professional spain travel nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bridget's Sexiest Beaches - Feeding Elephants In Thailand Fri, 10 Apr 2009 09:50:05 -0800

Author: travelchannel
Added: Fri, 10 Apr 2009 09:50:05 -0800
Duration: 0

Bridget explores the wild side of Thailand when she tries to feed a 45-year Old elephant. Bridget's Sexiest Beaches airs Thursdays at 10pm E/P on Travel Channel. travelchannel.com/bridget

]]> asiabananasbeachesbridgetelephantfeedmarquardtplayboyplaymatesexiestthailandwild http://revver.com/video/1582891/bridgets-sexiest-beaches-feeding-elephants-in-thailand/ http://revver.com/watch/1582891 Bridget's Sexiest Beaches - Feeding Elephants In Thailand Bridget explores the wild side of Thailand when she tries to feed a 45-year Old elephant. Bridget's Sexiest Beaches airs Thursdays at 10pm E/P on Travel Channel. travelchannel.com/bridget Bridget explores the wild side of Thailand when she tries to feed a 45-year Old elephant. Bridget's Sexiest Beaches airs Thursdays at 10pm E/P on Travel Channel. travelchannel.com/bridget travelchannel travelchannel asia bananas beaches bridget elephant feed marquardt playboy playmate sexiest thailand wild nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Travel Channel's Ultimate Spring Break Thu, 02 Apr 2009 03:52:40 -0800

Author: travelchannel
Added: Thu, 02 Apr 2009 03:52:40 -0800
Duration: 0

Travel Channel gives you the hottest tour of some of the break spring break spots around including Cancun, Panama City Beach, the Bahamas! Travel Channel's Ultimate Spring Break airs Thursday night, April 2nd at 11PM! http://www.travelchannel.com/

]]> bahamasbeachbreakcancunchannelcitycollegegirlshotpanamapartysexyspringsuntravelultimate http://revver.com/video/1570081/travel-channels-ultimate-spring-break/ http://revver.com/watch/1570081 Travel Channel's Ultimate Spring Break Travel Channel gives you the hottest tour of some of the break spring break spots around including Cancun, Panama City Beach, the Bahamas! Travel Channel's Ultimate Spring Break airs Thursday night, April 2nd at 11PM! http://www.travelchannel.com/ Travel Channel gives you the hottest tour of some of the break spring break spots around including Cancun, Panama City Beach, the Bahamas! Travel Channel's Ultimate Spring Break airs Thursday night, April 2nd at 11PM! http://www.travelchannel.com/ travelchannel travelchannel bahamas beach break cancun channel city college girls hot panama party sexy spring sun travel ultimate nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bridget's Sexiest Beaches - Reeling in a Barracuda Thu, 02 Apr 2009 03:52:40 -0800

Author: travelchannel
Added: Thu, 02 Apr 2009 03:52:40 -0800
Duration: 0

During her visit to Turks and Caicos, Bridget reels in a giant barracuda. Bridget's Sexiest Beaches airs Thursdays at 10pm E/P on Travel Channel. travelchannel.com/bridget

]]> bahamasbeachbreakcancunchannelcitycollegegirlshotpanamapartysexyspringsuntravelultimate http://revver.com/video/1570045/bridgets-sexiest-beaches-reeling-in-a-barracuda/ http://revver.com/watch/1570045 Bridget's Sexiest Beaches - Reeling in a Barracuda During her visit to Turks and Caicos, Bridget reels in a giant barracuda. Bridget's Sexiest Beaches airs Thursdays at 10pm E/P on Travel Channel. travelchannel.com/bridget During her visit to Turks and Caicos, Bridget reels in a giant barracuda. Bridget's Sexiest Beaches airs Thursdays at 10pm E/P on Travel Channel. travelchannel.com/bridget travelchannel travelchannel bahamas beach break cancun channel city college girls hot panama party sexy spring sun travel ultimate nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Dhani Tackles The Globe - Suiting Up In London Sat, 28 Mar 2009 16:36:21 -0800

Author: travelchannel
Added: Sat, 28 Mar 2009 16:36:21 -0800
Duration: 0

Dhani Jones pays a visit to Ozwald Boateng's for a private fitting with the famous taylor himself during his trip to London, England. Dhani Tackles The Globe airs Monday nights at 9PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Dhani_Jones

]]> artsboatengchanneldhanienglandfightingfootballglobejonesmartialmuaynflozwaldproprofessionalrugbytacklestaylorthaitravel http://revver.com/video/1561435/dhani-tackles-the-globe-suiting-up-in-london/ http://revver.com/watch/1561435 Dhani Tackles The Globe - Suiting Up In London Dhani Jones pays a visit to Ozwald Boateng's for a private fitting with the famous taylor himself during his trip to London, England. Dhani Tackles The Globe airs Monday nights at 9PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Dhani_Jones Dhani Jones pays a visit to Ozwald Boateng's for a private fitting with the famous taylor himself during his trip to London, England. Dhani Tackles The Globe airs Monday nights at 9PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Dhani_Jones travelchannel travelchannel arts boateng channel dhani england fighting football globe jones martial muay nfl ozwald pro professional rugby tackles taylor thai travel nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Dhani Tackles The Globe - Rugby Match Sat, 28 Mar 2009 16:36:21 -0800

Author: travelchannel
Added: Sat, 28 Mar 2009 16:36:21 -0800
Duration: 0

Dhani Jones puts his football skills to good use when he travels to London, and goes head-to-head with a team of English chaps on their own turf. Dhani Tackles The Globe airs Monday nights at 9PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Dhani_Jones

]]> artsboatengchanneldhanienglandfightingfootballglobejonesmartialmuaynflozwaldproprofessionalrugbytacklestaylorthaitravel http://revver.com/video/1561444/dhani-tackles-the-globe-rugby-match/ http://revver.com/watch/1561444 Dhani Tackles The Globe - Rugby Match Dhani Jones puts his football skills to good use when he travels to London, and goes head-to-head with a team of English chaps on their own turf. Dhani Tackles The Globe airs Monday nights at 9PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Dhani_Jones Dhani Jones puts his football skills to good use when he travels to London, and goes head-to-head with a team of English chaps on their own turf. Dhani Tackles The Globe airs Monday nights at 9PM, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Dhani_Jones travelchannel travelchannel arts boateng channel dhani england fighting football globe jones martial muay nfl ozwald pro professional rugby tackles taylor thai travel nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bridget's Sexiest Beaches - Dunn’s River Falls Wed, 25 Mar 2009 21:53:32 -0800

Author: travelchannel
Added: Wed, 25 Mar 2009 21:53:32 -0800
Duration: 97

Take a trip with Bridget when she visits Ocho Rios, Jamaica, and checks out Dunn’s River Falls -- a 695-foot waterfall tourists and locals enjoy climbing while being cascaded with warm fresh river water. Bridget's Sexiest Beaches airs Thursdays at 10pm E/P on Travel Channel. travelchannel.com/bridget

]]> beachesbridgetdunnsfallsislandjamaicamarquardtochoplayboyplaymateriosriversarasexiesttourismtouriststropicalunderwood http://revver.com/video/1555291/bridgets-sexiest-beaches-dunnrsquos-river-falls/ http://revver.com/watch/1555291 Bridget's Sexiest Beaches - Dunn’s River Falls Take a trip with Bridget when she visits Ocho Rios, Jamaica, and checks out Dunn’s River Falls -- a 695-foot waterfall tourists and locals enjoy climbing while being cascaded with warm fresh river water. Bridget's Sexiest Beaches airs Thursdays at 10pm E/P on Travel Channel. travelchannel.com/bridget Take a trip with Bridget when she visits Ocho Rios, Jamaica, and checks out Dunn’s River Falls -- a 695-foot waterfall tourists and locals enjoy climbing while being cascaded with warm fresh river water. Bridget's Sexiest Beaches airs Thursdays at 10pm E/P on Travel Channel. travelchannel.com/bridget travelchannel travelchannel beaches bridget dunns falls island jamaica marquardt ocho playboy playmate rios river sara sexiest tourism tourists tropical underwood nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bridget's Sexiest Beaches - Flying and Tanning Thu, 12 Mar 2009 23:52:47 -0800

Author: travelchannel
Added: Thu, 12 Mar 2009 23:52:47 -0800
Duration: 141

After a short flight in a single-engined plane, Bridget Marquardt gives us an intimate tour of Golden Horn Beach. Bridget's Sexiest Beaches premieres Thursday, March 12th at 10PM ET, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Bridget

]]> babesbeachbeachesbeautifulbeautybodybridgetcoverdubrovnikgirlgirlsgoldenheffnerhornhothughmansionmarquardtoceanplayboyplaymatesandsaraseasexiesttropicalunderwoodvacationworlds http://revver.com/video/1530824/bridgets-sexiest-beaches-flying-and-tanning/ http://revver.com/watch/1530824 Bridget's Sexiest Beaches - Flying and Tanning After a short flight in a single-engined plane, Bridget Marquardt gives us an intimate tour of Golden Horn Beach. Bridget's Sexiest Beaches premieres Thursday, March 12th at 10PM ET, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Bridget After a short flight in a single-engined plane, Bridget Marquardt gives us an intimate tour of Golden Horn Beach. Bridget's Sexiest Beaches premieres Thursday, March 12th at 10PM ET, only on Travel Channel. http://www.travelchannel.com/TV_Shows/Bridget travelchannel travelchannel babes beach beaches beautiful beauty body bridget cover dubrovnik girl girls golden heffner horn hot hugh mansion marquardt ocean playboy playmate sand sara sea sexiest tropical underwood vacation worlds nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Dhani Tackles The Globe - Thailand Preview Thu, 12 Mar 2009 16:33:28 -0800

Author: travelchannel
Added: Thu, 12 Mar 2009 16:33:28 -0800
Duration: 95

NFL star Dhani Jones gets a lesson in Muay Thai fighting in this clip from Travel Channel's new series, Dhani Tackles The Globe. Premieres Monday, March 16th at 9PM ET. http://www.travelchannel.com/TV_Shows/Dhani_Jones

]]> artschanneldhanifightingfootballglobejonesmartialmuaynflproprofessionaltacklesthaitravel http://revver.com/video/1529811/dhani-tackles-the-globe-thailand-preview/ http://revver.com/watch/1529811 Dhani Tackles The Globe - Thailand Preview NFL star Dhani Jones gets a lesson in Muay Thai fighting in this clip from Travel Channel's new series, Dhani Tackles The Globe. Premieres Monday, March 16th at 9PM ET. http://www.travelchannel.com/TV_Shows/Dhani_Jones NFL star Dhani Jones gets a lesson in Muay Thai fighting in this clip from Travel Channel's new series, Dhani Tackles The Globe. Premieres Monday, March 16th at 9PM ET. http://www.travelchannel.com/TV_Shows/Dhani_Jones travelchannel travelchannel arts channel dhani fighting football globe jones martial muay nfl pro professional tackles thai travel nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Anthony Bourdain - Banh Mi in Vietnam Tue, 10 Mar 2009 11:31:33 -0800

Author: travelchannel
Added: Tue, 10 Mar 2009 11:31:33 -0800
Duration: 95

Anthony Bourdain returns to Vietnam, a food destination like none other in the world, where he samples Banh Mi -- a hearty sandwich loaded with ham, cucumbers, dressing, and topped off with a fried egg. New episodes of Anthony Bourdain: No Reservations air Monday nights at 10PM ET, only on the Travel Channel. http://www.travelchannel.com/TV_Shows/Anthony_Bourdain

]]> asiaasianbanhbourdainchannelcilantrodressingeggfishfoodfriedhamhistoryminopastereservationssandwichthonytraditionaltraveltropicalvietnam http://revver.com/video/1522144/anthony-bourdain-banh-mi-in-vietnam/ http://revver.com/watch/1522144 Anthony Bourdain - Banh Mi in Vietnam Anthony Bourdain returns to Vietnam, a food destination like none other in the world, where he samples Banh Mi -- a hearty sandwich loaded with ham, cucumbers, dressing, and topped off with a fried egg. New episodes of Anthony Bourdain: No Reservations air Monday nights at 10PM ET, only on the Travel Channel. http://www.travelchannel.com/TV_Shows/Anthony_Bourdain Anthony Bourdain returns to Vietnam, a food destination like none other in the world, where he samples Banh Mi -- a hearty sandwich loaded with ham, cucumbers, dressing, and topped off with a fried egg. New episodes of Anthony Bourdain: No Reservations air Monday nights at 10PM ET, only on the Travel Channel. http://www.travelchannel.com/TV_Shows/Anthony_Bourdain travelchannel travelchannel asia asian banh bourdain channel cilantro dressing egg fish food fried ham history mi no paste reservations sandwich thony traditional travel tropical vietnam nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Anthony Bourdain - Disappearing Manhattan Special Mon, 23 Feb 2009 21:52:47 -0800

Author: travelchannel
Added: Mon, 23 Feb 2009 21:52:47 -0800
Duration: 156

Tony travels to one of the last old school Cantonese restaurants in Manhattan's Chinatown, where he samples classic dishes such as wonton soup, egg rolls, and bbq spare ribs. New episodes of Anthony Bourdain: No Reservations air Monday nights at 10PM ET, only on the Travel Channel. http://www.travelchannel.com/TV_Shows/Anthony_Bourdain

]]> anthonyasianbourdaincantonesechannelchinachinesecityfoodhopleemanhattannewnooldrecipesreservationsschooltowntraditionaltravelyork http://revver.com/video/1505270/anthony-bourdain-disappearing-manhattan-special/ http://revver.com/watch/1505270 Anthony Bourdain - Disappearing Manhattan Special Tony travels to one of the last old school Cantonese restaurants in Manhattan's Chinatown, where he samples classic dishes such as wonton soup, egg rolls, and bbq spare ribs. New episodes of Anthony Bourdain: No Reservations air Monday nights at 10PM ET, only on the Travel Channel. http://www.travelchannel.com/TV_Shows/Anthony_Bourdain Tony travels to one of the last old school Cantonese restaurants in Manhattan's Chinatown, where he samples classic dishes such as wonton soup, egg rolls, and bbq spare ribs. New episodes of Anthony Bourdain: No Reservations air Monday nights at 10PM ET, only on the Travel Channel. http://www.travelchannel.com/TV_Shows/Anthony_Bourdain travelchannel travelchannel anthony asian bourdain cantonese channel china chinese city food hop lee manhattan new no old recipes reservations school town traditional travel york nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mark & Olly - Adoptive Parents Sun, 22 Feb 2009 20:34:16 -0800

Author: travelchannel
Added: Sun, 22 Feb 2009 20:34:16 -0800
Duration: 125

A local villager gives Mark and Olly the responsibility of caring for an infant monkey that has fallen from the trees above and lost her mother. New episodes of Mark & Olly: Living With The Machigenga air Sundays at 10PM on Travel Channel. http://travelchannel.com/TV_Shows/Mark_and_Olly

]]> africaamazonansticebabycampchannelexploreexplorersforestinfantjunglelivingmachigengamarkmonkeynativesollysteedstraveltribaltribewildwilderness http://revver.com/video/1503644/mark-olly-adoptive-parents/ http://revver.com/watch/1503644 Mark & Olly - Adoptive Parents A local villager gives Mark and Olly the responsibility of caring for an infant monkey that has fallen from the trees above and lost her mother. New episodes of Mark & Olly: Living With The Machigenga air Sundays at 10PM on Travel Channel. http://travelchannel.com/TV_Shows/Mark_and_Olly A local villager gives Mark and Olly the responsibility of caring for an infant monkey that has fallen from the trees above and lost her mother. New episodes of Mark & Olly: Living With The Machigenga air Sundays at 10PM on Travel Channel. http://travelchannel.com/TV_Shows/Mark_and_Olly travelchannel travelchannel africa amazon anstice baby camp channel explore explorers forest infant jungle living machigenga mark monkey natives olly steeds travel tribal tribe wild wilderness nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Who's That Girl? Thu, 12 Feb 2009 00:34:33 -0800

Author: travelchannel
Added: Thu, 12 Feb 2009 00:34:33 -0800
Duration: 15

She'll be here on March 12th...Will You? http://www.travelchannel.com/

]]> bathingbeachesbunnychannelgirlgirlshostmysteryoceanparadisepromoseriesspotsuitssurprisetelevisionthattraveltropicaltvwhowhos http://revver.com/video/1488090/whos-that-girl/ http://revver.com/watch/1488090 Who's That Girl? She'll be here on March 12th...Will You? http://www.travelchannel.com/ She'll be here on March 12th...Will You? http://www.travelchannel.com/ travelchannel travelchannel bathing beaches bunny channel girl girls host mystery ocean paradise promo series spot suits surprise television that travel tropical tv who whos nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Anthony Bourdain: No Reservations Food Porn Mon, 09 Feb 2009 23:52:43 -0800

Author: travelchannel
Added: Mon, 09 Feb 2009 23:52:43 -0800
Duration: 88

Anthony Bourdain presents an X-rated selection of all that’s lip-smacking and luscious in the world of food. For hard-core viewers only! Anthony Bourdain: Food Porn airs Monday, February 9th at 10PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Anthony_Bourdain

]]> anthonyappealbourdaineatfoodmouthnopast. episodespornreservationssexsexyspecialwatering http://revver.com/video/1483917/anthony-bourdain-no-reservations-food-porn/ http://revver.com/watch/1483917 Anthony Bourdain: No Reservations Food Porn Anthony Bourdain presents an X-rated selection of all that’s lip-smacking and luscious in the world of food. For hard-core viewers only! Anthony Bourdain: Food Porn airs Monday, February 9th at 10PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Anthony_Bourdain Anthony Bourdain presents an X-rated selection of all that’s lip-smacking and luscious in the world of food. For hard-core viewers only! Anthony Bourdain: Food Porn airs Monday, February 9th at 10PM only on Travel Channel! http://www.travelchannel.com/TV_Shows/Anthony_Bourdain travelchannel travelchannel anthony appeal bourdain eat food mouth no past. episodes porn reservations sex sexy special watering nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Mark & Olly - Tracked By Natives Fri, 06 Feb 2009 21:52:42 -0800

Author: travelchannel
Added: Fri, 06 Feb 2009 21:52:42 -0800
Duration: 120

Explorers Mark Anstice and Olly Steeds are confronted by a native Peruvian after setting up camp deep in the Amazon. Mark & Olly: Living With The Machigenga premieres Sunday, Febrary 8th at 10PM only on Travel Channel! http://travelchannel.com/TV_Shows/Mark_and_Olly

]]> africaamazonansticecampchannelexploreexplorersforestjunglelivingmachigengamarknativesollysteedstraveltribaltribewildwilderness http://revver.com/video/1479073/mark-olly-tracked-by-natives/ http://revver.com/watch/1479073 Mark & Olly - Tracked By Natives Explorers Mark Anstice and Olly Steeds are confronted by a native Peruvian after setting up camp deep in the Amazon. Mark & Olly: Living With The Machigenga premieres Sunday, Febrary 8th at 10PM only on Travel Channel! http://travelchannel.com/TV_Shows/Mark_and_Olly Explorers Mark Anstice and Olly Steeds are confronted by a native Peruvian after setting up camp deep in the Amazon. Mark & Olly: Living With The Machigenga premieres Sunday, Febrary 8th at 10PM only on Travel Channel! http://travelchannel.com/TV_Shows/Mark_and_Olly travelchannel travelchannel africa amazon anstice camp channel explore explorers forest jungle living machigenga mark natives olly steeds travel tribal tribe wild wilderness nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Man v. Food - BBQ Shrimp in New Orleans Thu, 29 Jan 2009 06:52:38 -0800

Author: travelchannel
Added: Thu, 29 Jan 2009 06:52:38 -0800
Duration: 123

Adam travels to the Big Easy where he dives into a classic New Orleans Dish - BBQ shrimp. New episodes of Man v. Food air Wednesday nights at 10PM, only on the Travel Channel. http://travelchannel.com

]]> 2005adambbqbigcajunchallengechanneldisastereasyfloodfoodgulfhurricanekatrinamanneworleansrichmanshrimpsoulsouthspicesstormtravelversus http://revver.com/video/1465931/man-v-food-bbq-shrimp-in-new-orleans/ http://revver.com/watch/1465931 Man v. Food - BBQ Shrimp in New Orleans Adam travels to the Big Easy where he dives into a classic New Orleans Dish - BBQ shrimp. New episodes of Man v. Food air Wednesday nights at 10PM, only on the Travel Channel. http://travelchannel.com Adam travels to the Big Easy where he dives into a classic New Orleans Dish - BBQ shrimp. New episodes of Man v. Food air Wednesday nights at 10PM, only on the Travel Channel. http://travelchannel.com travelchannel travelchannel 2005 adam bbq big cajun challenge channel disaster easy flood food gulf hurricane katrina man new orleans richman shrimp soul south spices storm travel versus nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Anthony Bourdain - Azores Mon, 26 Jan 2009 21:31:43 -0800

Author: travelchannel
Added: Mon, 26 Jan 2009 21:31:43 -0800
Duration: 111

Tony visits the beautiful Azores, where he discusses the rise of ecotourism and samples gastronomic treats that make this cluster of islands so unique. New episodes of Anthony Bourdain: No Reservations air Monday nights at 10PM ET, only on the Travel Channel. http://www.travelchannel.com/TV_Shows/Anthony_Bourdain

]]> anthonyatlanticazoresbourdainchannelcleanecoecotourismenvironmentfoodgastronomicgastronomyimmigrantsislandslandmediterraneannooceanporkportuguesereservationstraditiontravel http://revver.com/video/1457901/anthony-bourdain-azores/ http://revver.com/watch/1457901 Anthony Bourdain - Azores Tony visits the beautiful Azores, where he discusses the rise of ecotourism and samples gastronomic treats that make this cluster of islands so unique. New episodes of Anthony Bourdain: No Reservations air Monday nights at 10PM ET, only on the Travel Channel. http://www.travelchannel.com/TV_Shows/Anthony_Bourdain Tony visits the beautiful Azores, where he discusses the rise of ecotourism and samples gastronomic treats that make this cluster of islands so unique. New episodes of Anthony Bourdain: No Reservations air Monday nights at 10PM ET, only on the Travel Channel. http://www.travelchannel.com/TV_Shows/Anthony_Bourdain travelchannel travelchannel anthony atlantic azores bourdain channel clean eco ecotourism environment food gastronomic gastronomy immigrants islands land mediterranean no ocean pork portuguese reservations tradition travel nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Man V. Food - New York City Thu, 22 Jan 2009 00:33:20 -0800

Author: travelchannel
Added: Thu, 22 Jan 2009 00:33:20 -0800
Duration: 32

Adam Richman returns home to New York City and tackles a one-pound sandwich at Katz's Delicatessen, savors soul food at Sylvia's Restaurant and is introduced to the hottest curry in the country at Brick Lane Curry House. New episodes of Man v. Food air Wednesday nights at 10PM, only on the Travel Channel. http://travelchannel.com

]]> adamapplebigbrickchannelcitycurrydelidelicatessenfoodhothousekatzlanemannewrichmansandwichspicytravelyork http://revver.com/video/1452509/man-v-food-new-york-city/ http://revver.com/watch/1452509 Man V. Food - New York City Adam Richman returns home to New York City and tackles a one-pound sandwich at Katz's Delicatessen, savors soul food at Sylvia's Restaurant and is introduced to the hottest curry in the country at Brick Lane Curry House. New episodes of Man v. Food air Wednesday nights at 10PM, only on the Travel Channel. http://travelchannel.com Adam Richman returns home to New York City and tackles a one-pound sandwich at Katz's Delicatessen, savors soul food at Sylvia's Restaurant and is introduced to the hottest curry in the country at Brick Lane Curry House. New episodes of Man v. Food air Wednesday nights at 10PM, only on the Travel Channel. http://travelchannel.com travelchannel travelchannel adam apple big brick channel city curry deli delicatessen food hot house katz lane man new richman sandwich spicy travel york nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Man v. Food - Sylvia's in New York City Wed, 21 Jan 2009 19:52:34 -0800

Author: travelchannel
Added: Wed, 21 Jan 2009 19:52:34 -0800
Duration: 99

Adam visits New York City's famous soul food restaurant Sylvia's where he chows down on southern style ribs and authentic fried chicken. New episodes of Man v. Food air Wednesday nights at 10PM, only on the Travel Channel. http://travelchannel.com

]]> adamapplebigbrickchannelcitycurrydelidelicatessenfoodhothousekatzlanemannewrichmansandwichspicysylviastravelyork http://revver.com/video/1453920/man-v-food-sylvias-in-new-york-city/ http://revver.com/watch/1453920 Man v. Food - Sylvia's in New York City Adam visits New York City's famous soul food restaurant Sylvia's where he chows down on southern style ribs and authentic fried chicken. New episodes of Man v. Food air Wednesday nights at 10PM, only on the Travel Channel. http://travelchannel.com Adam visits New York City's famous soul food restaurant Sylvia's where he chows down on southern style ribs and authentic fried chicken. New episodes of Man v. Food air Wednesday nights at 10PM, only on the Travel Channel. http://travelchannel.com travelchannel travelchannel adam apple big brick channel city curry deli delicatessen food hot house katz lane man new richman sandwich spicy sylvias travel york nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Anthony Bourdain - Ben's Chili Bowl in Washington, D.C. Sat, 17 Jan 2009 14:49:44 -0800

Author: travelchannel
Added: Sat, 17 Jan 2009 14:49:44 -0800
Duration: 146

Anthony visits the Washington, D.C. landmark Ben's Chili Bowl, where he tries a half smoke - a unique half pork, half beef smoked sausage covered in chili, mustard and onions. New episodes air Monday nights at 10PM ET, only on the Travel Channel. http://travelchannel.com/TV_Shows/Anthony_Bourdain

]]> anthonybarackbeefbensbourdainbowlbrotwerstchannelchilidcelectfoodhotdogmarylandnoobamaporkpresidentreservationssausagetravelvirginiavisitwashington http://revver.com/video/1444613/anthony-bourdain-bens-chili-bowl-in-washington-dc/ http://revver.com/watch/1444613 Anthony Bourdain - Ben's Chili Bowl in Washington, D.C. Anthony visits the Washington, D.C. landmark Ben's Chili Bowl, where he tries a half smoke - a unique half pork, half beef smoked sausage covered in chili, mustard and onions. New episodes air Monday nights at 10PM ET, only on the Travel Channel. http://travelchannel.com/TV_Shows/Anthony_Bourdain Anthony visits the Washington, D.C. landmark Ben's Chili Bowl, where he tries a half smoke - a unique half pork, half beef smoked sausage covered in chili, mustard and onions. New episodes air Monday nights at 10PM ET, only on the Travel Channel. http://travelchannel.com/TV_Shows/Anthony_Bourdain travelchannel travelchannel anthony barack beef bens bourdain bowl brotwerst channel chili dc elect food hotdog maryland no obama pork president reservations sausage travel virginia visit washington nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Man v. Food - Boston’s Eagle Challenge Burger Mon, 12 Jan 2009 23:31:45 -0800

Author: travelchannel
Added: Mon, 12 Jan 2009 23:31:45 -0800
Duration: 144

Adam travels to Boston, where he visits Eagle's Deli to take on the Eagle Challenge - a 5 pound burger, 2 pounds of bacon and cheese, and 5 pounds of fries! New episodes of Man v. Food air Wednesday nights at 10PM, only on the Travel Channel. http://travelchannel.com

]]> adambostonburgerschallengechannelcoastdelieagleseastenglandfoodfriesmanmassmassachusettsnewrestaurantrichmantravel http://revver.com/video/1435258/man-v-food-bostonrsquos-eagle-challenge-burger/ http://revver.com/watch/1435258 Man v. Food - Boston’s Eagle Challenge Burger Adam travels to Boston, where he visits Eagle's Deli to take on the Eagle Challenge - a 5 pound burger, 2 pounds of bacon and cheese, and 5 pounds of fries! New episodes of Man v. Food air Wednesday nights at 10PM, only on the Travel Channel. http://travelchannel.com Adam travels to Boston, where he visits Eagle's Deli to take on the Eagle Challenge - a 5 pound burger, 2 pounds of bacon and cheese, and 5 pounds of fries! New episodes of Man v. Food air Wednesday nights at 10PM, only on the Travel Channel. http://travelchannel.com travelchannel travelchannel adam boston burgers challenge channel coast deli eagles east england food fries man mass massachusetts new restaurant richman travel nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Anthony Bourdain - Seafood Risotto in Venice Fri, 09 Jan 2009 21:52:35 -0800

Author: travelchannel
Added: Fri, 09 Jan 2009 21:52:35 -0800
Duration: 166

In this clip from an all-new episode of Anthony Bourdain: No Reservations, Tony travels to Venice where he learns the history and preparation of seafood risotto. Watch Monday nights at 10PM ET, only on the Travel Channel. http://www.travelchannel.com/TV_Shows/Anthony_Bourdain

]]> anthonybourdainchannelcuisineeuropeeuropeanfirefishfoodgillitalianitalynoreservationsricerisottoseafoodtraditionaltravelvenicewood http://revver.com/video/1430183/anthony-bourdain-seafood-risotto-in-venice/ http://revver.com/watch/1430183 Anthony Bourdain - Seafood Risotto in Venice In this clip from an all-new episode of Anthony Bourdain: No Reservations, Tony travels to Venice where he learns the history and preparation of seafood risotto. Watch Monday nights at 10PM ET, only on the Travel Channel. http://www.travelchannel.com/TV_Shows/Anthony_Bourdain In this clip from an all-new episode of Anthony Bourdain: No Reservations, Tony travels to Venice where he learns the history and preparation of seafood risotto. Watch Monday nights at 10PM ET, only on the Travel Channel. http://www.travelchannel.com/TV_Shows/Anthony_Bourdain travelchannel travelchannel anthony bourdain channel cuisine europe european fire fish food gill italian italy no reservations rice risotto seafood traditional travel venice wood nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Man v. Food - Atlanta's Carnivore Pizza Mon, 05 Jan 2009 19:52:37 -0800

Author: travelchannel
Added: Mon, 05 Jan 2009 19:52:37 -0800
Duration: 30

Don't miss the next all-new Man v. Food when Adam visits Atlanta and attacks a pizza so huge, he has to call in help to face the challenge! New episodes of Man v. Food air Wednesday nights at 10PM, only on the Travel Channel. http://travelchannel.com

]]> adamatlantacarnivorechannelfoodgeorgiaitalianlovermanmeatpiepizzarichmansouthtravel http://revver.com/video/1421456/man-v-food-atlantas-carnivore-pizza/ http://revver.com/watch/1421456 Man v. Food - Atlanta's Carnivore Pizza Don't miss the next all-new Man v. Food when Adam visits Atlanta and attacks a pizza so huge, he has to call in help to face the challenge! New episodes of Man v. Food air Wednesday nights at 10PM, only on the Travel Channel. http://travelchannel.com Don't miss the next all-new Man v. Food when Adam visits Atlanta and attacks a pizza so huge, he has to call in help to face the challenge! New episodes of Man v. Food air Wednesday nights at 10PM, only on the Travel Channel. http://travelchannel.com travelchannel travelchannel adam atlanta carnivore channel food georgia italian lover man meat pie pizza richman south travel nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Man v. Food - The Italian Stance Fri, 19 Dec 2008 23:31:46 -0800

Author: travelchannel
Added: Fri, 19 Dec 2008 23:31:46 -0800
Duration: 132

Adam is shown the proper way to eat an Italian beef sandwich when he visits Al's Beef in Chicago. New episodes of Man v. Food air Wednesday nights at 10PM, only on the Travel Channel. http://travelchannel.com

]]> adambeefchannelchicagofoodgarlicillinoisitalianjuicemanpeppersrichmansandwichstancesunsweettravel http://revver.com/video/1391606/man-v-food-the-italian-stance/ http://revver.com/watch/1391606 Man v. Food - The Italian Stance Adam is shown the proper way to eat an Italian beef sandwich when he visits Al's Beef in Chicago. New episodes of Man v. Food air Wednesday nights at 10PM, only on the Travel Channel. http://travelchannel.com Adam is shown the proper way to eat an Italian beef sandwich when he visits Al's Beef in Chicago. New episodes of Man v. Food air Wednesday nights at 10PM, only on the Travel Channel. http://travelchannel.com travelchannel travelchannel adam beef channel chicago food garlic illinois italian juice man peppers richman sandwich stance sun sweet travel nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Anthony Bourdain - All-New Season Premieres Monday, Jan. 5! Wed, 17 Dec 2008 19:49:38 -0800

Author: travelchannel
Added: Wed, 17 Dec 2008 19:49:38 -0800
Duration: 80

Tony travels to Mexico where he dines on tacos so fresh, you can only find them south of the border! An all-new season of Anthony Bourdain: No Reservations premieres Monday, January 5 at 10PM ET, only on the Travel Channel. http://www.travelchannel.com/TV_Shows/Anthony_Bourdain

]]> anthonybourdainchannelchefcookcuisineeatfoodfreshingredientsjanuarylatinolimelocalmexicosalsatacostraveltripvacation http://revver.com/video/1387244/anthony-bourdain-all-new-season-premieres-monday-jan-5/ http://revver.com/watch/1387244 Anthony Bourdain - All-New Season Premieres Monday, Jan. 5! Tony travels to Mexico where he dines on tacos so fresh, you can only find them south of the border! An all-new season of Anthony Bourdain: No Reservations premieres Monday, January 5 at 10PM ET, only on the Travel Channel. http://www.travelchannel.com/TV_Shows/Anthony_Bourdain Tony travels to Mexico where he dines on tacos so fresh, you can only find them south of the border! An all-new season of Anthony Bourdain: No Reservations premieres Monday, January 5 at 10PM ET, only on the Travel Channel. http://www.travelchannel.com/TV_Shows/Anthony_Bourdain travelchannel travelchannel anthony bourdain channel chef cook cuisine eat food fresh ingredients january latino lime local mexico salsa tacos travel trip vacation nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Man v. Food - Juan In A Million Fri, 12 Dec 2008 21:52:34 -0800

Author: travelchannel
Added: Fri, 12 Dec 2008 21:52:34 -0800
Duration: 85

Adam prepares for a food showdown when he travels to Austin, Texas to beat the “Don Juan El Taco Grande” breakfast taco challenge record at the local favorite Juan In A Million. New episodes of Man v. Food air Wednesday nights at 10PM, only on the Travel Channel. http://travelchannel.com

]]> adamaustinchallengechanneldoneatfoodjuanmanmexicanmexicomillionrichmansouthwestspicytacostexastravel http://revver.com/video/1376960/man-v-food-juan-in-a-million/ http://revver.com/watch/1376960 Man v. Food - Juan In A Million Adam prepares for a food showdown when he travels to Austin, Texas to beat the “Don Juan El Taco Grande” breakfast taco challenge record at the local favorite Juan In A Million. New episodes of Man v. Food air Wednesday nights at 10PM, only on the Travel Channel. http://travelchannel.com Adam prepares for a food showdown when he travels to Austin, Texas to beat the “Don Juan El Taco Grande” breakfast taco challenge record at the local favorite Juan In A Million. New episodes of Man v. Food air Wednesday nights at 10PM, only on the Travel Channel. http://travelchannel.com travelchannel travelchannel adam austin challenge channel don eat food juan man mexican mexico million richman southwest spicy tacos texas travel nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Man v. Food - Austin Fri, 12 Dec 2008 06:52:48 -0800

Author: travelchannel
Added: Fri, 12 Dec 2008 06:52:48 -0800
Duration: 30

Adam takes on the Don Juan Taco Challenge and attempts to down eight breakfast tacos when he heads to Austin, Texas to see what the southwest has to offer! New episodes of Man v. Food air Wednesday nights at 10PM, only on the Travel Channel. http://travelchannel.com

]]> adamaustinbreakfastchallengechanneldoneatfoodjuanmanmexicanmexicorichmansouthwestspicytacostexastravel http://revver.com/video/1374735/man-v-food-austin/ http://revver.com/watch/1374735 Man v. Food - Austin Adam takes on the Don Juan Taco Challenge and attempts to down eight breakfast tacos when he heads to Austin, Texas to see what the southwest has to offer! New episodes of Man v. Food air Wednesday nights at 10PM, only on the Travel Channel. http://travelchannel.com Adam takes on the Don Juan Taco Challenge and attempts to down eight breakfast tacos when he heads to Austin, Texas to see what the southwest has to offer! New episodes of Man v. Food air Wednesday nights at 10PM, only on the Travel Channel. http://travelchannel.com travelchannel travelchannel adam austin breakfast challenge channel don eat food juan man mexican mexico richman southwest spicy tacos texas travel nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Man v. Food - Primanti's in Pittsburgh Tue, 09 Dec 2008 17:52:39 -0800

Author: travelchannel
Added: Tue, 09 Dec 2008 17:52:39 -0800
Duration: 115

Adam visits Primanti Bros., a local Pittsburgh hotspot where he feasts on a mega-sized sandwich filled with meat, egg, cheese, slaw, and fries! New episodes of Travel Channel's Man v. Food air Wednesday nights at 10PM, only on Travel Channel! http://travelchannel.com

]]> adambarchanneldelifoodfriesgrillmanmidwestpaninipennsylvaniapittsburghpubrestaurantrichmansandwichtravel http://revver.com/video/1369419/man-v-food-primantis-in-pittsburgh/ http://revver.com/watch/1369419 Man v. Food - Primanti's in Pittsburgh Adam visits Primanti Bros., a local Pittsburgh hotspot where he feasts on a mega-sized sandwich filled with meat, egg, cheese, slaw, and fries! New episodes of Travel Channel's Man v. Food air Wednesday nights at 10PM, only on Travel Channel! http://travelchannel.com Adam visits Primanti Bros., a local Pittsburgh hotspot where he feasts on a mega-sized sandwich filled with meat, egg, cheese, slaw, and fries! New episodes of Travel Channel's Man v. Food air Wednesday nights at 10PM, only on Travel Channel! http://travelchannel.com travelchannel travelchannel adam bar channel deli food fries grill man midwest panini pennsylvania pittsburgh pub restaurant richman sandwich travel nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Travel Channel's Man v. Food - The Big Texan Challenge Mon, 01 Dec 2008 18:52:36 -0800

Author: travelchannel
Added: Mon, 01 Dec 2008 18:52:36 -0800
Duration: 427

Host Adam Richman competes to see who can eat a 72 oz. steak dinner the fastest in this clip from Travel Channel's Man v. Food. Premieres Wednesday, December 3rd at 10pm on the Travel Channel. http://travelchannel.com

]]> adamamarillobbqbeefbigchallengechannelcompetitioncontesteatfoodmanmeatranchrichmansaloonsouthsouthweststeaksteakhousetexantexastravel http://revver.com/video/1352714/travel-channels-man-v-food-the-big-texan-challenge/ http://revver.com/watch/1352714 Travel Channel's Man v. Food - The Big Texan Challenge Host Adam Richman competes to see who can eat a 72 oz. steak dinner the fastest in this clip from Travel Channel's Man v. Food. Premieres Wednesday, December 3rd at 10pm on the Travel Channel. http://travelchannel.com Host Adam Richman competes to see who can eat a 72 oz. steak dinner the fastest in this clip from Travel Channel's Man v. Food. Premieres Wednesday, December 3rd at 10pm on the Travel Channel. http://travelchannel.com travelchannel travelchannel adam amarillo bbq beef big challenge channel competition contest eat food man meat ranch richman saloon south southwest steak steakhouse texan texas travel nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bizarre Foods - Uganda Mon, 01 Dec 2008 18:52:36 -0800

Author: travelchannel
Added: Mon, 01 Dec 2008 18:52:36 -0800
Duration: 123

Andrew travels to Uganda where he samples local specialties such as brazed goat, roasted grasshopper, and grilled squirrel. New episodes of Bizarre Foods air Tuesdays at 10 PM only on the Travel Channel. Visit http://travelchannel.com/bizarre

]]> africaandrewbizarrebrazedchannelcookeatfoodsgoatgrasshoppergrilledgrownlocalroastedsquirrelstocktravelugandazimmern http://revver.com/video/1352564/bizarre-foods-uganda/ http://revver.com/watch/1352564 Bizarre Foods - Uganda Andrew travels to Uganda where he samples local specialties such as brazed goat, roasted grasshopper, and grilled squirrel. New episodes of Bizarre Foods air Tuesdays at 10 PM only on the Travel Channel. Visit http://travelchannel.com/bizarre Andrew travels to Uganda where he samples local specialties such as brazed goat, roasted grasshopper, and grilled squirrel. New episodes of Bizarre Foods air Tuesdays at 10 PM only on the Travel Channel. Visit http://travelchannel.com/bizarre travelchannel travelchannel africa andrew bizarre brazed channel cook eat foods goat grasshopper grilled grown local roasted squirrel stock travel uganda zimmern nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Ghost Adventures - The Edinburgh Vaults Tue, 25 Nov 2008 16:33:22 -0800

Author: travelchannel
Added: Tue, 25 Nov 2008 16:33:22 -0800
Duration: 30

The Ghost Adventures crew travels to Scotland to investigate what still lurks in the Edinburgh vaults deep beneath the city. New episodes of Ghost Adventures air Friday nights at 9PM only on the The Travel Channel! For more info, visit: http://www.travelchannel.com/TV_Shows/Ghost_Adventures

]]> aaronadventuresancientbaganschannelcriminalsedinburghenglandeuropeevilghostgoodwingoulsgroffhaunthauntingshistoryhousesinsanementalnickparanormalscaryscotlandsightingsspiritsspookytraveltunnelszak http://revver.com/video/1340889/ghost-adventures-the-edinburgh-vaults/ http://revver.com/watch/1340889 Ghost Adventures - The Edinburgh Vaults The Ghost Adventures crew travels to Scotland to investigate what still lurks in the Edinburgh vaults deep beneath the city. New episodes of Ghost Adventures air Friday nights at 9PM only on the The Travel Channel! For more info, visit: http://www.travelchannel.com/TV_Shows/Ghost_Adventures The Ghost Adventures crew travels to Scotland to investigate what still lurks in the Edinburgh vaults deep beneath the city. New episodes of Ghost Adventures air Friday nights at 9PM only on the The Travel Channel! For more info, visit: http://www.travelchannel.com/TV_Shows/Ghost_Adventures travelchannel travelchannel aaron adventures ancient bagans channel criminals edinburgh england europe evil ghost goodwin gouls groff haunt hauntings history houses insane mental nick paranormal scary scotland sightings spirits spooky travel tunnels zak nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bizarre Foods - June Bug 3 Ways Mon, 17 Nov 2008 16:33:21 -0800

Author: travelchannel
Added: Mon, 17 Nov 2008 16:33:21 -0800
Duration: 119

Andrew and his father sample june bugs prepared several unique ways while at a summer party in Maine. New episodes of Bizarre Foods air Tuesdays at 10 PM only on the Travel Channel. Visit http://travelchannel.com/bizarre

]]> 3andrewatlanticballbbqbizarrebugschannelchocolateenglandfishfishingfoodsinsectsjunejunenipperlobstermainemaltnewoceanscallionsthreetravelwayszimmern http://revver.com/video/1324211/bizarre-foods-june-bug-3-ways/ http://revver.com/watch/1324211 Bizarre Foods - June Bug 3 Ways Andrew and his father sample june bugs prepared several unique ways while at a summer party in Maine. New episodes of Bizarre Foods air Tuesdays at 10 PM only on the Travel Channel. Visit http://travelchannel.com/bizarre Andrew and his father sample june bugs prepared several unique ways while at a summer party in Maine. New episodes of Bizarre Foods air Tuesdays at 10 PM only on the Travel Channel. Visit http://travelchannel.com/bizarre travelchannel travelchannel 3 andrew atlantic ball bbq bizarre bugs channel chocolate england fish fishing foods insects june junenipper lobster maine malt new ocean scallions three travel ways zimmern nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Ghosts Adventures - Sloss Furnace Fri, 14 Nov 2008 13:52:36 -0800

Author: travelchannel
Added: Fri, 14 Nov 2008 13:52:36 -0800
Duration: 30

Temperatures rise when the Ghost Adventures crew enters the lock down at Alabama's Sloss Furnace in Birmingham. New episodes of Ghost Adventures air Friday nights at 9PM only on the The Travel Channel! http://travelchannel.com

]]> aaronadventuresalabamabagansbirminghamchannelevilfurnaceghostgoodwingoulsgroffhaunthauntingshousesnickparanormalscarysightingsslossspiritsspookytravelzak http://revver.com/video/1315191/ghosts-adventures-sloss-furnace/ http://revver.com/watch/1315191 Ghosts Adventures - Sloss Furnace Temperatures rise when the Ghost Adventures crew enters the lock down at Alabama's Sloss Furnace in Birmingham. New episodes of Ghost Adventures air Friday nights at 9PM only on the The Travel Channel! http://travelchannel.com Temperatures rise when the Ghost Adventures crew enters the lock down at Alabama's Sloss Furnace in Birmingham. New episodes of Ghost Adventures air Friday nights at 9PM only on the The Travel Channel! http://travelchannel.com travelchannel travelchannel aaron adventures alabama bagans birmingham channel evil furnace ghost goodwin gouls groff haunt hauntings houses nick paranormal scary sightings sloss spirits spooky travel zak nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Travel Channel's Man v. Food - Hot Wings Wed, 12 Nov 2008 19:33:04 -0800

Author: travelchannel
Added: Wed, 12 Nov 2008 19:33:04 -0800
Duration: 144

In Travel Channel's Man v. Food, host Adam Richman takes on some of the biggest, baddest food challenges in the country. He'll go coast to coast to see if he's man enough for America's epic eats. http://travelchannel.com

]]> adamadventurebuffalocantinachallengechannelculturefoodhothotwingsmanrichmansixsuicidetravelwings http://revver.com/video/1313002/travel-channels-man-v-food-hot-wings/ http://revver.com/watch/1313002 Travel Channel's Man v. Food - Hot Wings In Travel Channel's Man v. Food, host Adam Richman takes on some of the biggest, baddest food challenges in the country. He'll go coast to coast to see if he's man enough for America's epic eats. http://travelchannel.com In Travel Channel's Man v. Food, host Adam Richman takes on some of the biggest, baddest food challenges in the country. He'll go coast to coast to see if he's man enough for America's epic eats. http://travelchannel.com travelchannel travelchannel adam adventure buffalo cantina challenge channel culture food hot hotwings man richman six suicide travel wings nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bizarre Foods - Raw Meat in Ethiopia Sat, 08 Nov 2008 06:54:48 -0800

Author: travelchannel
Added: Sat, 08 Nov 2008 06:54:48 -0800
Duration: 114

While traveling through Ethiopia, Andrew samples a cultural delicacy: raw meat dipped in lemon juice and spices. New episodes of Bizarre Foods air Tuesdays at 10 PM only on the Travel Channel. Visit http://travelchannel.com/bizarre

]]> africanandrewbeefbizarrebloodycamelchannelchickencowethiopiafleshfoodsjerkyjunglemeatrawshockingspicytravelzimmern http://revver.com/video/1305937/bizarre-foods-raw-meat-in-ethiopia/ http://revver.com/watch/1305937 Bizarre Foods - Raw Meat in Ethiopia While traveling through Ethiopia, Andrew samples a cultural delicacy: raw meat dipped in lemon juice and spices. New episodes of Bizarre Foods air Tuesdays at 10 PM only on the Travel Channel. Visit http://travelchannel.com/bizarre While traveling through Ethiopia, Andrew samples a cultural delicacy: raw meat dipped in lemon juice and spices. New episodes of Bizarre Foods air Tuesdays at 10 PM only on the Travel Channel. Visit http://travelchannel.com/bizarre travelchannel travelchannel african andrew beef bizarre bloody camel channel chicken cow ethiopia flesh foods jerky jungle meat raw shocking spicy travel zimmern nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Ghost Adventures - Moundsville Prison Tue, 28 Oct 2008 21:55:17 -0800

Author: travelchannel
Added: Tue, 28 Oct 2008 21:55:17 -0800
Duration: 106

Zak Bagans and his crew of paranormal investigators set their sights on Moundsville penitentiary in West Virginia. Notorious for having been one of the most violent prisons in the country, it's believed that the men who died there still haunt the facility to this day. New episodes of Ghost Adventures air Fridays at 9pm ET only on Travel Channel! http://www.travelchannel.com/TV_Shows/Ghost_Adventures

]]> aaronadventuresbaganschannelevilghostgoodwingoulsgroffhalloweenhaunthauntingshousesjailmoundsvillenickoctoberparanormalpenitentiaryprisonprisonersscarysightingsspiritsspookytravelvirginiawestzak http://revver.com/video/1285451/ghost-adventures-moundsville-prison/ http://revver.com/watch/1285451 Ghost Adventures - Moundsville Prison Zak Bagans and his crew of paranormal investigators set their sights on Moundsville penitentiary in West Virginia. Notorious for having been one of the most violent prisons in the country, it's believed that the men who died there still haunt the facility to this day. New episodes of Ghost Adventures air Fridays at 9pm ET only on Travel Channel! http://www.travelchannel.com/TV_Shows/Ghost_Adventures Zak Bagans and his crew of paranormal investigators set their sights on Moundsville penitentiary in West Virginia. Notorious for having been one of the most violent prisons in the country, it's believed that the men who died there still haunt the facility to this day. New episodes of Ghost Adventures air Fridays at 9pm ET only on Travel Channel! http://www.travelchannel.com/TV_Shows/Ghost_Adventures travelchannel travelchannel aaron adventures bagans channel evil ghost goodwin gouls groff halloween haunt hauntings houses jail moundsville nick october paranormal penitentiary prison prisoners scary sightings spirits spooky travel virginia west zak nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bizarre Worlds - Turkey's Underground City Mon, 27 Oct 2008 18:55:11 -0800

Author: travelchannel
Added: Mon, 27 Oct 2008 18:55:11 -0800
Duration: 114

Andrew Zimmern tours one of Turkey's ancient underground cities in this clip from Bizarre Worlds. Premieres October 28th at 9pm ET only on Travel Channel! http://www.travelchannel.com/TV_Shows/Bizarre_Worlds

]]> ancientandrewbizarrechannelcityeastfoodshiddenlostmiddleruinstravelturkeyundergroundworldszimmern http://revver.com/video/1282573/bizarre-worlds-turkeys-underground-city/ http://revver.com/watch/1282573 Bizarre Worlds - Turkey's Underground City Andrew Zimmern tours one of Turkey's ancient underground cities in this clip from Bizarre Worlds. Premieres October 28th at 9pm ET only on Travel Channel! http://www.travelchannel.com/TV_Shows/Bizarre_Worlds Andrew Zimmern tours one of Turkey's ancient underground cities in this clip from Bizarre Worlds. Premieres October 28th at 9pm ET only on Travel Channel! http://www.travelchannel.com/TV_Shows/Bizarre_Worlds travelchannel travelchannel ancient andrew bizarre channel city east foods hidden lost middle ruins travel turkey underground worlds zimmern nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bizarre Foods - Hawaiian Bone Fish Mon, 27 Oct 2008 18:55:11 -0800

Author: travelchannel
Added: Mon, 27 Oct 2008 18:55:11 -0800
Duration: 115

Andrew enjoys a traditional Hawaiian L‘au including scooped bone fish and octopus in this clip from Bizarre Foods. New episodes air Tuesdays at 10 PM on Travel Channel. Visit http://travelchannel.com/bizarre

]]> andrewbizarrebonechannelfeastfishfoodshawaiihawaiianhulal&lsquoaumealoceanoctopuspacificpigroasttraditiontraveltropicalzimmern http://revver.com/video/1282584/bizarre-foods-hawaiian-bone-fish/ http://revver.com/watch/1282584 Bizarre Foods - Hawaiian Bone Fish Andrew enjoys a traditional Hawaiian L‘au including scooped bone fish and octopus in this clip from Bizarre Foods. New episodes air Tuesdays at 10 PM on Travel Channel. Visit http://travelchannel.com/bizarre Andrew enjoys a traditional Hawaiian L‘au including scooped bone fish and octopus in this clip from Bizarre Foods. New episodes air Tuesdays at 10 PM on Travel Channel. Visit http://travelchannel.com/bizarre travelchannel travelchannel andrew bizarre bone channel feast fish foods hawaii hawaiian hula l&lsquoau meal ocean octopus pacific pig roast tradition travel tropical zimmern nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bizarre Foods - Halloween Special Fri, 17 Oct 2008 22:54:08 -0800

Author: travelchannel
Added: Fri, 17 Oct 2008 22:54:08 -0800
Duration: 103

Andrew Zimmern serves his costume party guests some truly ghastly delights including guinea pig in this clip from the Bizarre Foods Halloween special! Tuesday, October 21st at 10pm ET on the Travel Channel http://www.travelchannel.com/TV_Shows/Bizarre_Foods

]]> andrewbizarrechannelcostumefoodsguineahalloweenoctoberpartypigtraveltreattrickwinezimmern http://revver.com/video/1257295/bizarre-foods-halloween-special/ http://revver.com/watch/1257295 Bizarre Foods - Halloween Special Andrew Zimmern serves his costume party guests some truly ghastly delights including guinea pig in this clip from the Bizarre Foods Halloween special! Tuesday, October 21st at 10pm ET on the Travel Channel http://www.travelchannel.com/TV_Shows/Bizarre_Foods Andrew Zimmern serves his costume party guests some truly ghastly delights including guinea pig in this clip from the Bizarre Foods Halloween special! Tuesday, October 21st at 10pm ET on the Travel Channel http://www.travelchannel.com/TV_Shows/Bizarre_Foods travelchannel travelchannel andrew bizarre channel costume foods guinea halloween october party pig travel treat trick wine zimmern nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ At The Table with Anthony Bourdain Fri, 17 Oct 2008 07:54:08 -0800

Author: travelchannel
Added: Fri, 17 Oct 2008 07:54:08 -0800
Duration: 30

Get more at http://www.travelchannel.com/TV_Shows/Anthony_Bourdain Watch this Anthony Bourdain special, Monday, Oct. 20, at 10 p.m. ET, only on the Travel Channel.

]]> allenamyanthonyatbourdainchriseyeguymaximnewpeekpromoqueersaccoshowsneakstraightabletalktedvideowilson http://revver.com/video/1252913/at-the-table-with-anthony-bourdain/ http://revver.com/watch/1252913 At The Table with Anthony Bourdain Get more at http://www.travelchannel.com/TV_Shows/Anthony_Bourdain Watch this Anthony Bourdain special, Monday, Oct. 20, at 10 p.m. ET, only on the Travel Channel. Get more at http://www.travelchannel.com/TV_Shows/Anthony_Bourdain Watch this Anthony Bourdain special, Monday, Oct. 20, at 10 p.m. ET, only on the Travel Channel. travelchannel travelchannel allen amy anthony at bourdain chris eye guy maxim new peek promo queer sacco show sneak straigh table talk ted video wilson nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bizarre Foods in Los Angeles: Baby Piglet Tue, 14 Oct 2008 12:34:37 -0800

Author: travelchannel
Added: Tue, 14 Oct 2008 12:34:37 -0800
Duration: 95

A whole baby pig, served with deep fried pig's ears and a warm tongue salad... all in a day's work for Andrew Zimmern on Bizarre Foods in Los Angeles. Bizarre Foods airs Tuesdays at 10 PM on Travel Channel. Visit http://travelchannel.com/bizarre

]]> andrewangelesbabybizarrecheeseearseatingfoodsheadlospigletzimmern http://revver.com/video/1243779/bizarre-foods-in-los-angeles-baby-piglet/ http://revver.com/watch/1243779 Bizarre Foods in Los Angeles: Baby Piglet A whole baby pig, served with deep fried pig's ears and a warm tongue salad... all in a day's work for Andrew Zimmern on Bizarre Foods in Los Angeles. Bizarre Foods airs Tuesdays at 10 PM on Travel Channel. Visit http://travelchannel.com/bizarre A whole baby pig, served with deep fried pig's ears and a warm tongue salad... all in a day's work for Andrew Zimmern on Bizarre Foods in Los Angeles. Bizarre Foods airs Tuesdays at 10 PM on Travel Channel. Visit http://travelchannel.com/bizarre travelchannel travelchannel andrew angeles baby bizarre cheese ears eating foods head los piglet zimmern nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Most Haunted Live: Dancer In The Dark Tue, 07 Oct 2008 00:46:53 -0800

Author: travelchannel
Added: Tue, 07 Oct 2008 00:46:53 -0800
Duration: 35

On October 10th, 2008 at 8 PM EST Travel Channel and the Most Haunted team will travel to Gettysburg, PA to investigate 100 years of ghostly sightings. http://www.travelchannel.com/TV_Shows/Most_Haunted_Live

]]> americaapparitionbeattichannelcivilfearfieldinggettysburgghostghostshauntedhauntingkarllivemostorbpaulpennsylvaniaphotoproofrossscaryspectralspookytravelusawaryvette http://revver.com/video/1197474/most-haunted-live-dancer-in-the-dark/ http://revver.com/watch/1197474 Most Haunted Live: Dancer In The Dark On October 10th, 2008 at 8 PM EST Travel Channel and the Most Haunted team will travel to Gettysburg, PA to investigate 100 years of ghostly sightings. http://www.travelchannel.com/TV_Shows/Most_Haunted_Live On October 10th, 2008 at 8 PM EST Travel Channel and the Most Haunted team will travel to Gettysburg, PA to investigate 100 years of ghostly sightings. http://www.travelchannel.com/TV_Shows/Most_Haunted_Live travelchannel travelchannel america apparition beatti channel civil fear fielding gettysburg ghost ghosts haunted haunting karl live most orb paul pennsylvania photo proof ross scary spectral spooky travel usa war yvette nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Bizarre Foods Samoa: Yellowfin Heart Sun, 05 Oct 2008 23:53:00 -0800

Author: travelchannel
Added: Sun, 05 Oct 2008 23:53:00 -0800
Duration: 138

Andrew goes deep sea fishing in the south Pacific, where he samples a beating yellowfin heart. Bizarre Foods airs Tuesdays at 10 PM on Travel Channel. Visit http://travelchannel.com/bizarre

]]> andrewbizzaredisgustingentertainmentfinfoodsgrossnewspacificpalolosamoasouthtunawormyellowzimmern http://revver.com/video/1208928/bizarre-foods-samoa-yellowfin-heart/ http://revver.com/watch/1208928 Bizarre Foods Samoa: Yellowfin Heart Andrew goes deep sea fishing in the south Pacific, where he samples a beating yellowfin heart. Bizarre Foods airs Tuesdays at 10 PM on Travel Channel. Visit http://travelchannel.com/bizarre Andrew goes deep sea fishing in the south Pacific, where he samples a beating yellowfin heart. Bizarre Foods airs Tuesdays at 10 PM on Travel Channel. Visit http://travelchannel.com/bizarre travelchannel travelchannel andrew bizzare disgusting entertainment fin foods gross news pacific palolo samoa south tuna worm yellow zimmern nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Most Haunted Live: Train Station Voices Sat, 04 Oct 2008 14:52:51 -0800

Author: travelchannel
Added: Sat, 04 Oct 2008 14:52:51 -0800
Duration: 46

On October 10th, 2008 at 8 PM EST Travel Channel and the Most Haunted team will travel to Gettysburg, PA to investigate 100 years of ghostly sightings. http://www.travelchannel.com/TV_Shows/Most_Haunted_Live

]]> americaapparitionbeattichannelcivilfearfieldinggettysburgghostghostshauntedhauntingkarllivemostorbpaulpennsylvaniaphotoproofrossscaryspectralspookytravelusawaryvette http://revver.com/video/1197484/most-haunted-live-train-station-voices/ http://revver.com/watch/1197484 Most Haunted Live: Train Station Voices On October 10th, 2008 at 8 PM EST Travel Channel and the Most Haunted team will travel to Gettysburg, PA to investigate 100 years of ghostly sightings. http://www.travelchannel.com/TV_Shows/Most_Haunted_Live On October 10th, 2008 at 8 PM EST Travel Channel and the Most Haunted team will travel to Gettysburg, PA to investigate 100 years of ghostly sightings. http://www.travelchannel.com/TV_Shows/Most_Haunted_Live travelchannel travelchannel america apparition beatti channel civil fear fielding gettysburg ghost ghosts haunted haunting karl live most orb paul pennsylvania photo proof ross scary spectral spooky travel usa war yvette nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Most Haunted Live: Ghost of General Robert E. Lee in Gettysburg Sat, 04 Oct 2008 08:33:39 -0800

Author: travelchannel
Added: Sat, 04 Oct 2008 08:33:39 -0800
Duration: 31

On October 10th, 2008 at 8 PM EST Travel Channel and the Most Haunted team will travel to Gettysburg, PA to investigate 100 years of ghostly sightings. http://www.travelchannel.com/TV_Shows/Most_Haunted_Live

]]> americaapparitionbeattichannelcivilfearfieldinggettysburgghostghostshauntedhauntingkarllivemostorbpaulpennsylvaniaphotoproofrossscaryspectralspookytravelusawaryvette http://revver.com/video/1194545/most-haunted-live-ghost-of-general-robert-e-lee-in-gettysburg/ http://revver.com/watch/1194545 Most Haunted Live: Ghost of General Robert E. Lee in Gettysburg On October 10th, 2008 at 8 PM EST Travel Channel and the Most Haunted team will travel to Gettysburg, PA to investigate 100 years of ghostly sightings. http://www.travelchannel.com/TV_Shows/Most_Haunted_Live On October 10th, 2008 at 8 PM EST Travel Channel and the Most Haunted team will travel to Gettysburg, PA to investigate 100 years of ghostly sightings. http://www.travelchannel.com/TV_Shows/Most_Haunted_Live travelchannel travelchannel america apparition beatti channel civil fear fielding gettysburg ghost ghosts haunted haunting karl live most orb paul pennsylvania photo proof ross scary spectral spooky travel usa war yvette nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Most Haunted Live: Undoctored Photo of Gettysburg Ghosts Wed, 01 Oct 2008 16:33:26 -0800

Author: travelchannel
Added: Wed, 01 Oct 2008 16:33:26 -0800
Duration: 50

On October 10th, 2008 at 8 PM EST Travel Channel and the Most Haunted team will travel to Gettysburg, PA to investigate 100 years of ghostly sightings. http://www.travelchannel.com/TV_Shows/Most_Haunted_Live

]]> americaapparitionbeattichannelcivilfearfieldinggettysburgghostghostshauntedhauntingkarllivemostorbpaulpennsylvaniaphotoproofrossscaryspectralspookytravelusawaryvette http://revver.com/video/1197489/most-haunted-live-undoctored-photo-of-gettysburg-ghosts/ http://revver.com/watch/1197489 Most Haunted Live: Undoctored Photo of Gettysburg Ghosts On October 10th, 2008 at 8 PM EST Travel Channel and the Most Haunted team will travel to Gettysburg, PA to investigate 100 years of ghostly sightings. http://www.travelchannel.com/TV_Shows/Most_Haunted_Live On October 10th, 2008 at 8 PM EST Travel Channel and the Most Haunted team will travel to Gettysburg, PA to investigate 100 years of ghostly sightings. http://www.travelchannel.com/TV_Shows/Most_Haunted_Live travelchannel travelchannel america apparition beatti channel civil fear fielding gettysburg ghost ghosts haunted haunting karl live most orb paul pennsylvania photo proof ross scary spectral spooky travel usa war yvette nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Most Haunted Live: First Ghost Sighting in Gettysburg Wed, 01 Oct 2008 12:33:25 -0800

Author: travelchannel
Added: Wed, 01 Oct 2008 12:33:25 -0800
Duration: 30

On October 10th, 2008 at 8 PM EST Travel Channel and the Most Haunted team will travel to Gettysburg, PA to investigate 100 years of ghostly sightings. http://www.travelchannel.com/TV_Shows/Most_Haunted_Live

]]> americaapparitionbeattichannelcivilfearfieldinggettysburgghostghostshauntedhauntingkarllivemostorbpaulpennsylvaniaphotoproofrossscaryspectralspookytravelusawaryvette http://revver.com/video/1194542/most-haunted-live-first-ghost-sighting-in-gettysburg/ http://revver.com/watch/1194542 Most Haunted Live: First Ghost Sighting in Gettysburg On October 10th, 2008 at 8 PM EST Travel Channel and the Most Haunted team will travel to Gettysburg, PA to investigate 100 years of ghostly sightings. http://www.travelchannel.com/TV_Shows/Most_Haunted_Live On October 10th, 2008 at 8 PM EST Travel Channel and the Most Haunted team will travel to Gettysburg, PA to investigate 100 years of ghostly sightings. http://www.travelchannel.com/TV_Shows/Most_Haunted_Live travelchannel travelchannel america apparition beatti channel civil fear fielding gettysburg ghost ghosts haunted haunting karl live most orb paul pennsylvania photo proof ross scary spectral spooky travel usa war yvette nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Most Haunted Live: Gettysburg Trailer Wed, 01 Oct 2008 12:33:25 -0800

Author: travelchannel
Added: Wed, 01 Oct 2008 12:33:25 -0800
Duration: 60

On October 10th at 8 PM EST Travel Channel and the Most Haunted team travel to Gettysburg, PA for the first ever LIVE investigation of the most haunted town in America. http://www.travelchannel.com/TV_Shows/Most_Haunted_Live

]]> americaapparitionbeattichannelcivilfearfieldinggettysburgghostghostshauntedhauntingkarllivemostorbpaulpennsylvaniaphotoproofrossscaryspectralspookytravelusawaryvette http://revver.com/video/1194551/most-haunted-live-gettysburg-trailer/ http://revver.com/watch/1194551 Most Haunted Live: Gettysburg Trailer On October 10th at 8 PM EST Travel Channel and the Most Haunted team travel to Gettysburg, PA for the first ever LIVE investigation of the most haunted town in America. http://www.travelchannel.com/TV_Shows/Most_Haunted_Live On October 10th at 8 PM EST Travel Channel and the Most Haunted team travel to Gettysburg, PA for the first ever LIVE investigation of the most haunted town in America. http://www.travelchannel.com/TV_Shows/Most_Haunted_Live travelchannel travelchannel america apparition beatti channel civil fear fielding gettysburg ghost ghosts haunted haunting karl live most orb paul pennsylvania photo proof ross scary spectral spooky travel usa war yvette nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Most Haunted Live: The Holy Grail Wed, 01 Oct 2008 07:52:35 -0800

Author: travelchannel
Added: Wed, 01 Oct 2008 07:52:35 -0800
Duration: 41

On October 10th, 2008 at 8 PM EST Travel Channel and the Most Haunted team will travel to Gettysburg, PA to investigate 100 years of ghostly sightings. http://www.travelchannel.com/TV_Shows/Most_Haunted_Live

]]> americaapparitionbeattichannelcivilfearfieldinggettysburgghostghostshauntedhauntingkarllivemostorbpaulpennsylvaniaphotoproofrossscaryspectralspookytravelusawaryvette http://revver.com/video/1197481/most-haunted-live-the-holy-grail/ http://revver.com/watch/1197481 Most Haunted Live: The Holy Grail On October 10th, 2008 at 8 PM EST Travel Channel and the Most Haunted team will travel to Gettysburg, PA to investigate 100 years of ghostly sightings. http://www.travelchannel.com/TV_Shows/Most_Haunted_Live On October 10th, 2008 at 8 PM EST Travel Channel and the Most Haunted team will travel to Gettysburg, PA to investigate 100 years of ghostly sightings. http://www.travelchannel.com/TV_Shows/Most_Haunted_Live travelchannel travelchannel america apparition beatti channel civil fear fielding gettysburg ghost ghosts haunted haunting karl live most orb paul pennsylvania photo proof ross scary spectral spooky travel usa war yvette nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/ Most Haunted Live: I Felt Like I was Being Watched Sat, 27 Sep 2008 08:34:01 -0800

Author: travelchannel
Added: Sat, 27 Sep 2008 08:34:01 -0800
Duration: 62

On October 10th, 2008 at 8 PM EST Travel Channel and the Most Haunted team will travel to Gettysburg, PA to investigate 100 years of ghostly sightings. http://www.travelchannel.com/TV_Shows/Most_Haunted_Live

]]> americabeattichannelghostshauntingkarlorbpaulproofrosstravelusa http://revver.com/video/1197478/most-haunted-live-i-felt-like-i-was-being-watched/ http://revver.com/watch/1197478 Most Haunted Live: I Felt Like I was Being Watched On October 10th, 2008 at 8 PM EST Travel Channel and the Most Haunted team will travel to Gettysburg, PA to investigate 100 years of ghostly sightings. http://www.travelchannel.com/TV_Shows/Most_Haunted_Live On October 10th, 2008 at 8 PM EST Travel Channel and the Most Haunted team will travel to Gettysburg, PA to investigate 100 years of ghostly sightings. http://www.travelchannel.com/TV_Shows/Most_Haunted_Live travelchannel travelchannel america beatti channel ghosts haunting karl orb paul proof ross travel usa nonadult http://creativecommons.org/licenses/by-nc-nd/2.5/